Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G06930-AT5G49020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):protein arginine methyltransferase 4B
Function (paralog2):protein arginine methyltransferase 4A

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.77380852535986
Log2 mRNA fold difference:-0.033111015979671
Log2 TE fold difference:-0.75805933364173
Sequences
Protein sequence

MEVSSVKKLEQLEYSLESVTDLSSSSVSSSSPAVATFSYVDGVTELRFLQSDSTHCFNFD
LASAQLFKLGPVHFICVSDGSSSSEEKSFSKGVNIKFKNEKDSKDFCESFEEWRNDSVVQ
GSSLQNGTVSANKSKFDNKIEASSAKMYFHYYGQLLHQQNMLQDYVRTGTYYAAVMENHS
DFAGRVVVDVGAGSGILSMFAAQAGAKHVYAVEASEMAEYARKLIAGNPLFADRITVIKG
KVEDIELPEKADILISEPMGTLLVNERMLESYVIARDRFMTPKGKMFPTVGRIHMAPFSD
EFLFIEMANKAMFWQQQNYYGVDLTPLYGSAHQGYFSQPVVDAFDPRLLVASPMFHMIDF
TQMKEEDFYEIDIPLKFTASMCTRMHGLACWFDVLFDGSTVQRWLTTAPGAPTTHWYQIR
CVLSQPIYVMAGQEITGRLHLIAHSAQSYTIDLTLSAKMWGPGASQGGILQSSTCKFDLK
EPYYRMSQPQAYPVAQEPPLQPQPELSTQQDIQTPNDELEEELLQQLPQNPSAQL

MEIPSLNKQQEFTLASVTDLTSPSSSLSSSPVVATFSCVNEVKELRFQESKSSDGFSFDL
SSTQLFKLGPLQFTCVSDGSISSAKEKSSFSRGVVIKFRDEKDSKEFCDSFEECKKDDAV
KQGSALPNGTVVSANKSKFDDKIEAASAKMYFHYYGQLLHQQNMLQDYVRTGTYHAAVME
NRSDFSGRVVVDVGAGSGILSMFAALAGAKHVYAVEASEMAEYARKLIAGNPLLAERITV
IKGKIEDIELPEKADVLISEPMGTLLVNERMLETYVIARDRFLSPNGKMFPTVGRIHMAP
FADEFLFVEMANKALFWQQQNYYGVDLTPLYVSAHQGYFSQPVVDAFDPRLLVAPSMFHV
IDFTMMTEEQFYEIDIPLKFTASVCTRIHGLACWFDVLFDGSTVQRWFTTAPGAPTTHWY
QIRCVLSQPIHVMAGQEITGRLHLIAHSAQSYTINLTLSAKMWGPGANQGGILQTSSCKL
DLKEPYYRMSQPQVYPTQEPPAQSQDIHIHSDDLEELELLQQNANAQL

www.000webhost.com

Other information
Ka divergence:-0.0293388KaKs divergence:0.185933
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1608Length 2 (bp):1587Length divergence:-0.007
MFE 1 (kcal):-462.63MFE 2 (kcal):-481.93MFE divergence0.02