Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07010-AT5G48900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pectin lyase-like superfamily protein
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.27671302600759
Log2 mRNA fold difference:0.10323018772148
Log2 TE fold difference:0.20216029631977
Sequences
Protein sequence

MAVTKLILFASALLLTALFIGVNASRSNETWHEHAVENPDEVAAMVDMSIRNSTERRRLG
YFSCATGNPIDDCWRCDRKWQLRRKRLADCSIGFGRNAIGGRDGRFYVVTDPGDDDPVNP
IPGTLRHAVIQDEPLWIIFKRDMVITLKQELIMNSFKTIDGRGVNVHIANGACLTIQYVT
NIIVHGIHVHDCKPTGNAMVRSSPSHYGFRSMADGDAISIFGSSHIWIDHNSLSNCADGL
VDAVMSSTAITVSNNFFTHHNEVMLLGHSDSYTRDKVMQVTIAYNHFGEGLIQRMPRCRH
GYFHVVNNDYTHWEMYAIGGSAGPTINSQGNRFLAPVNPFAKEVTKREYTGESKWKHWNW
RSEGDLFLNGAFFTRSGAGAGANYARASSLSAKSSSLVGTMTSYSGALNCRAGRRC

MAVTQILVVFASALLLSMFFTGVDSTRSNETWHEHAVENPEEVAAMVDMSIRNSTARRRL
GYFSCSTGNPIDDCWRCDRRWQSRRKHLANCAIGFGRNAIGGRDGRYYVVSDPNDDNPVN
PKPGTLRHAVIQEEPLWIVFKRDMVITLKEELIMNSFKTIDGRGVNVHIANGACITIQFV
TNIIIHGIHIHDCRPTGNAMVRSSPSHYGWRTMADGDGISIFGSSHIWIDHNSLSNCADG
LIDAVMASTAITISNNYFTHHNEVMLLGHSDTYTRDKVMQVTIAYNHFGEGLIQRMPRCR
HGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAPRNRFAKEVTKRDYAGQWQWRHWN
WRSEGDLFLNGAFFTRSGSGLGASYARASSLAAKSSSLVGVITYNAGALNCRGGRRC

Other information
Ka divergence:-0.0469263KaKs divergence:-0.0267315
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1251Length 2 (bp):1254Length divergence:0.001
MFE 1 (kcal):-402.31MFE 2 (kcal):-370.47MFE divergence-0.041