Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07110-AT5G48760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L13 family protein
Function (paralog2):Ribosomal protein L13 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.4709890658424
Log2 mRNA fold difference:-1.3184432646585
Log2 TE fold difference:-0.14757370564309
Sequences
Protein sequence

MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYM
RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALARLKVFEGVPTPYDKI
KRMVVPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKQELENKRKERAQAVYERKKQL
SKLRAKAEKVAEEKLGSQLDVLAPVKY

MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYM
RFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALARLKVYEGVPTPYDKI
KRMVIPDALKVLRLQAGHKYCLLGRLSSEVGWNHYDTIKELETKRKERAHVVYERKKQLN
KLRVKAEKVAEEKLGAQLDILAPVKY

Other information
Ka divergence:-0.346803KaKs divergence:-0.759933
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):624Length 2 (bp):621Length divergence:-0.002
MFE 1 (kcal):-205MFE 2 (kcal):-214.3MFE divergence0.022