Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07170-AT5G48680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sterile alpha motif (SAM) domain-containing protein
Function (paralog2):Sterile alpha motif (SAM) domain-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.019870206651826
Log2 mRNA fold difference:-0.58908137120823
Log2 TE fold difference:0.61009168833392
Sequences
Protein sequence

MYADKLEAESGSRKVVKDRINGGSGDISTRVRQVTGKRQRQDDKWEHDLFSSDKPQLSNR
RVDPRDLRLKLQKRHHGSQSGREAGSGVRDLRDQLSGTMNQQPKNSDPPKSKAEAARPSM
KSVATETETRKTSSQATRKKSQQADSSVDSFLESLGLEKYSTAFQVEEVDMDALMHMTDD
DLKAMLIPMGPRKKILLALGSKP

MYSDLVVAETKISKTFKNRLNGGSGDFSSRGKQQQVTRKRGRQDDDKWEHDLFEDDDEPR
LSKRRVDPKDLRLKLQKKRHGSQIGGRVFSVSVADLRDKLSRTVNPQTKNSKREAVRPAI
KKVSVGTKPETRAAPNRATKKDPQQNDASVDSFLESLGLEKYSTAFQVEEVDMDALRHMT
DDDLKALLIPMGPRKKILLALGDNRG

www.000webhost.com

Other information
Ka divergence:0.456297KaKs divergence:0.0338908
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):612Length 2 (bp):621Length divergence:0.007
MFE 1 (kcal):-181.33MFE 2 (kcal):-177.36MFE divergence-0.011