Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07190-AT5G48660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):B-cell receptor-associated protein 31-like
Function (paralog2):B-cell receptor-associated protein 31-like

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.4818671509553
Log2 mRNA fold difference:-0.11415159221855
Log2 TE fold difference:-0.54600762730879
Sequences
Protein sequence

MIQLLFLVLFVEGAIAFLLLVKIGPLRELVMKSLDQLKLGKRPATLKTIAGTMSVILLSN
LMNIIKIQNKGAKLGTMSPMDQVLWRTHLLEASLMGVVLFFGFIIDRTHHYLEKLITLRS
NVGSSKGELEELRKERIELKEKEEKTSKEIKQLKEKLSCVSENLKKLEKESKEKETKLET
AEAHVTALQKQSSELLLEYDRLLEDNQNLQSQILVGTKKT

MIQLLFLVLFVEGAIAFLLLIKIGPLRELVIKSLDQMKMGKGPATVKTIAGTMSVILFSN
LMSIVKIQNKGAKLGTMSPMDQVLWRTHLLEASLLGVVLFLGFIIDRMHHYLRKLINLRS
NVGSSKEELEQLQKERTELKEKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKLET
AETHVTALQKQSAELLLEYDRLLEDNQHLQSQILGKTKS

www.000webhost.com

Other information
Ka divergence:-0.237122KaKs divergence:-0.614576
GC content 1 (%):42GC content 2 (%):39GC content divergence:-0.037
Length 1 (bp):663Length 2 (bp):660Length divergence:-0.002
MFE 1 (kcal):-175.9MFE 2 (kcal):-172.6MFE divergence-0.009