Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07200-AT5G48655
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.12107359289235
Log2 mRNA fold difference:0.39976722305471
Log2 TE fold difference:-0.51267456935661
Sequences
Protein sequence

MASRVVRTSMRLRRRDGVTQNEHQGDQQVADQAPTVPQIVATPPRINVVAIEDDDDVVES
TASAFAQAKNKSRSARRGSQVVDVESAGANRSTRRRSDQTSVDSVELNKPRKSKAVAPPV
EEPKFSCPICLCPFTQEVSTKCGHIFCKKCIKNALSLQAKCPTCRKKITVKDLIRVFLPT
TR

MNTSEVRVPRGNRRRKAVIDLNAVPVDQEGTSASVRTLTVPITPSQPAPTMIDVDAIEDD
VIESSASAFAEAKSKSRNARRRPLMVDVESGGTTRFPANISNKRRRIPSSESVIDCEHAS
VNDEVNMSSRVSRSKAPAPPPEEPKFTCPICMCPFTEEMSTKCGHIFCKGCIKMAISRQG
KCPTCRKKVTAKELIRVFLPTTR

www.000webhost.com

Other information
Ka divergence:-0.192417KaKs divergence:-0.57967
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):549Length 2 (bp):612Length divergence:0.054
MFE 1 (kcal):-158.1MFE 2 (kcal):-194.2MFE divergence0.102