Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07220-AT3G07260
Species:Arabidopsis
Duplication type:TD
Function (paralog1):SMAD/FHA domain-containing protein
Function (paralog2):SMAD/FHA domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-7.6594211488939
Log2 mRNA fold difference:-7.3022368213126
Log2 TE fold difference:-0.87190925305988
Sequences
Protein sequence

MATAVGGGSDVEVGFAKLQGEDFEYYMQSYSIILGRNSKKATVDVDLSSLGGGMNISRNH
ARIFYDFTRRRFSLEVLGKNGCLVEGVLHLPGNPNVKLDSQDLLQIGDKEFYFLLPVRSI
LGGPLGPRHHVSGQTSVVPYHNYQSGPGSGSGKKGVRSRELYEYDDEDDDDDDDEEDDMR
GSGKKTRRDGHEVVYASGEKKREGRSKVDREADDQQFLQLEEKDVVSSVATVLSDLCGPG
EWMPMEKLHSVILKEYGNVWHHSRVRRYLSQEDWAIPEAKGKPWYGLLMLLRKYPEHFVI
NTRSKGRVTLEFVSLVTLLS

MATAVGSGSDVEVGFAKLQGEDFEYYMQSYSIILGRNSKKSTVDVDLSSLGGGMNISRNH
ARIFYDFTRRRFSLEVLGKNGCFVEGVLHLPGNPNVKLDSQDLLQIGDKEFYFLLPVWSI
LGGPLGPRHHVLGKATVVPYHNYHSGPGSGSGKNGVRSRELYEYDDEDDDEEEDIRGSGK
KTWRDGHEGVYASGEKKREGRSKADREADDQQFLQLMHGSGWSVTDIKGVWKRMASQSSK
KIPITRRLGYP

www.000webhost.com

Other information
Ka divergence:-0.0520174KaKs divergence:0.999869
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):963Length 2 (bp):756Length divergence:-0.12
MFE 1 (kcal):-298.21MFE 2 (kcal):-241.9MFE divergence-0.104