Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07310-AT5G48590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF760)
Function (paralog2):Protein of unknown function (DUF760)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.70356894200955
Log2 mRNA fold difference:-1.3317636269995
Log2 TE fold difference:0.58531116045034
Sequences
Protein sequence

MDSCLSNQTALQFLPSRSRRQSGDGGGGFVIPAKRKIQYSSMVVVAAAGQSRCEPGSSLN
APLEPRSAQGRFLRSVLLNKRQLFHYAAADELKQLADDREAALARMSLSSGSDEASLHRR
IAELKERYCKTAVQDIMYMLIFYKYSEIRVPLVPKLSRCIYNGRLEIWPSKDWELESIYS
CDTLEIIKEHVSAVIGLRVNSCVTDNWATTQIQKLHLRKVYAASILYGYFLKSASLRHQL
ECSLSDIHGSGYLKSPIFGCSFTTGTAQISNKQQLRHYISDFDPETLQRCAKPRTEEARN
LIEKQSLALFGTEESDETIVTSFSSLKRLVLEAVAFGTFLWDTELYVDGAYKLKENGNAE
EQEGKKSI

MDTSLSHHGSLPFPPSRRNFVKQNRGGDCVFLPSRRKFRYDSLVVVSAASSGQSIDAPLV
PRSPQGRFLSSVLVKKRQLFHFAVADLLKQLADDKEASLSRMFLSYGSDEASLHRRIAQL
KESDCQIAIEDIMYMLILYKFSEIRVPLVPKLPSCIYNGRLEISPSKDWELESIHSFDVL
ELIKEHSNAVISLRVNSSLTDDCATTEIDKNRLSKVYTASVLYGYFLKSASLRHQLECSL
SQHHGSFTKQLRHYISEFDPKILRRCAKPRSHEAKSLIEKQSLALFGPEESSKESIVTSF
SSLKRLLLEAVAFGTFLWDTEEYVDGAFKLKENENAEEETNSSV

Other information
Ka divergence:0.284131KaKs divergence:0.73366
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1107Length 2 (bp):1035Length divergence:-0.034
MFE 1 (kcal):-351.22MFE 2 (kcal):-318.8MFE divergence-0.048