Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07340-AT5G48560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Function (paralog2):basic helix-loop-helix (bHLH) DNA-binding superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.62382363020318
Log2 mRNA fold difference:-0.32873656337525
Log2 TE fold difference:-0.32150416586719
Sequences
Protein sequence

MENELFMNAGVSHPPVMTSPSSSSAMLKWVSMETQPVDPSLSRNLFWEKSTEQSIFDSAL
SSLVSSPTPSNSNFSVGGVGGENVIMRELIGKLGNIGDIYGITASNGNSCYATPMSSPPP
GSMMETKTTTPMAELSGDPGFAERAARFSCFGSRSFNSRTNSPFPINNEPPITTNEKMPR
VSSSPVFKPLASHVPAGESSGELSRKRKTKSKQNSPSAVSSSKEIEEKEDSDPKRCKKSE
ENGDKTKSIDPYKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKVTGK
ALMLDEIINYVQSLQRQVEFLSMKLSSVNTRLDFNMDALLSKDIFPSSNNLMHHQQVLQL
DSSAETLLGDHHNKNLQLNPDISSNNVINPLETSETRSFISHLPTLAHFTDSISQYSTFS
EDDLHSIIHMGFAQNRLQELNQGSSNQVPSHMKAEL

MDNELFMNTEFPPPPEMATHFEHQQSSSSAMMLNWALMDPNPHQDSSFLWEKSTEQQQQQ
SIFDSALSSLVSSPTPSNSNFSGGGGDGFLIRELIGKLGNIGNNNNNSGEIYGTPMSRSA
SCYATPMSSPPPPTNSNSQMMMNRTTPLTEFSADPGFAERAARFSCFGSRSFNGRTNTNL
PINNGNNMVNNSGKLTRVSSTPALKALVSPEVTPGGEFSRKRKSVPKGKSKENPISTASP
SPSFSKTAEKNGGKGGSKSSEEKGGKRRREEEDDEEEEGEGEGNKSNNTKPPEPPKDYIH
VRARRGQATDSHSLAERVRREKIGERMKLLQDLVPGCNKVTGKALMLDEIINYVQSLQRQ
VEFLSMKLSSVNDTRLDFNVDALVSKDVMIPSSNNRLHEEGLQSKSSSHHHQQQLNIYNN
NSQLLPNISSNNMMLQSPMNSLETSTLARSFTHLPTLTQFTDSISQYQMFSEEDLQSIVG
MGVAENPNNESQHMKIEL

www.000webhost.com

Other information
Ka divergence:0.0702888KaKs divergence:0.0614643
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1371Length 2 (bp):1497Length divergence:0.044
MFE 1 (kcal):-401.24MFE 2 (kcal):-410.23MFE divergence0.011