Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07460-AT3G07470
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function, DUF538
Function (paralog2):Protein of unknown function, DUF538

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3641555667087
Log2 mRNA fold difference:-1.5294866661133
Log2 TE fold difference:0.1278989794308
Sequences
Protein sequence

MLRIVQITLLCFVLAAGISISAVIAENESIDEILLANGLPLGLFPKGVKGFTVNGETGRF
SVYLNQSCQAKYETELHYDEIVSGTIGYAQIRDLSGISAQELFLWLQVKGIRVDVPSSGL
IFFDVGVLRKQYSLSLFETPRDCVAVRGDAEFIGSVFDVAIVSSRSNSWKKHCLAGVEEM
LLYYTRKMEKIDRCSHLFLKILSTVLISNLRHDSWSDASFFPFPHPSVVSALLSPDCEGD
RTERICERKLDGNNDVRIGLEKMLNEWLRFG

MMLRIVQIAFLCLVLVAGISISTAISETETIYEILLANGLPSGIFPKGVREFTFDVETGR
FSVYLNQACEAKYETEIHYDANITGTIGSAQISDLSGISAQELFLWFPVKGIRVDVPSSG
LIYFDVGVVRKQYSLSLFETPRDCVPVRGIHKVELPLYRVDQNLGRNII

www.000webhost.com

Other information
Ka divergence:-0.187355KaKs divergence:-0.930322
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):816Length 2 (bp):510Length divergence:-0.231
MFE 1 (kcal):-241.82MFE 2 (kcal):-167.7MFE divergence-0.181