Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07520-AT5G48410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutamate receptor 1.4
Function (paralog2):glutamate receptor 1.3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.44436774618241
Log2 mRNA fold difference:-1.4049125986519
Log2 TE fold difference:0.95470735000502
Sequences
Protein sequence

MENCMIRNTGYFLTIFFLAFISFAVTCSGTNQKDNVDRLPVVYEDVRIGLVVDMGSMEGK
LVTTSISMALSDFYHVNNGYRTRVSVLSRDSHGDPLQALAAAMDLLQTEQVEALVGGQSL
LEAKNLAELGEKTKVPVISSFQVPSSLSLAKYNYFIQATHDTSSEAKGIAALFSNFDWRT
AVLIYEDDDDWRESIQPLVGHFQQNAIHIEYKAEFSVSSNEECIMKQLRKFKASGIRIFV
AHISERIANRLFPCARRLGMMEEGYAWILTARSMNNFQDTNYLAKEEMEGVIGFKSYIPL
TEELHNFTLRWKRSLRLEEVVTRMSVCSIWAHDIAWSLARAAEVAKLPGLSVYDLLEAIP
ESAKHKGLSGDIKFIDKKFISDKFEIVNMIGRGERSVGLWNSGSFISNRRRRLSSTKALE
TIIWPGGSTRIPKIRSLKEKRHGKKKKLRVLVPAGNITPQILEVKTDFKTGVTAATGYCI
DVFETSILPFNYEVEYIPWPGAINYKNYNDLVYTLYSQKDKYDAAVGDITITDNRSLYVD
FTLPFTDMGLAVVTAKDKSMWIIFKPLTLSLWLTIASFFILTGAIVWLIERHDNADFQGS
CFQQIGTLLCFGFSTLVFAHRERLQHNMSRFVVIVWIFAVLILTSNYTATLTSVMTVQQI
RGLKSNENIGFFSASIAANVVNDNPTFQGPRYKGLKTADDFTNALRNGTISFIVDEVPYV
KLFVAKHPSEFVIVETESVTNGFGFAFQKGSPLVQKVSREIEKLRRTEKLKAIENWWFQR
QTTSATSEDTFHPLTVYTFRGLFMITGVSFAFALIVYLIPWNREQRQVVLKHFHRYVSHR
FAREIRPSPTTPNRQNENSVI

MERFCIQTQTLLSFLLVLLLFISRSFASTKNDDVDGGKRVQIRVGLVLDLGSLKGKIVKN
SVSMALSYFYAIHNDYKTRVSVSLRNSHGEPLLALASAVDLLKTEGVEAIIGGNSLLEAK
LLGELGEKARVPMISLDSPFSLSLSKYTHLIQATHDSTSEAKGITSFINVFDWNSVALVY
EDHDDWRESMQLLVEHFHENGVRVQSKVGFTVSSSEDFVMGRLQQLKDLGTTVFVVHLSE
VIATHLFPCARRLGLMGDGFVWILTAKTMNSFHENIDDFTKQAMEGVVGFKSYIPMSIEL
QNFTLRWRKSLPVEEAELTRLSISGIWAHDIAFALARAAEVIRMPNVTSTLLEEITKTRF
NGLSGDFQLNDKKLLSNKFEIINMIGSSERRVGFLNSNGSFSNRRHLSSTHNKLETIIWP
GGSAQSPKGTSLIDSDRKKLRVLVTSSNRFPRLMKVETDPVTNELIVEGFCIEVFRASIS
PFNYEVEYIPWLNGSNYDNLAYALHSQKDKYDAAVGDITITSNRSTYVDFTLPFTEMGLG
IVAVKERSMWVFFQPLTPDLWITSAFFFVLTGVIVWLIERAENKEFQGSWPQQIGVVLWF
GFSTLVYAHREKLKHNLSRFVVTVWVFAVLILTASYTATLTSMMTVQQIRFNSNEDYVGH
LSGSLIANVALTSSSLRAMRSLGLNSAADYAQALLNKTVSFVVDELPYLKVVLGENPTHF
FMVKTQSTTNGFGFMFQKGFELVPNVSREISKLRTSEKLNEMEKRWFDNQLPYTTDDTSN
PITLYRFRGLFIIIGVSFAFALAVLVILCLRDKWEILVDNLDLSQRLRHFRIHFVRSIHT
SPLDDPIGETAVQMAQQNRQ

www.000webhost.com

Other information
Ka divergence:-0.00748782KaKs divergence:-0.000718649
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):2586Length 2 (bp):2583Length divergence:-0.001
MFE 1 (kcal):-762.98MFE 2 (kcal):-763.36MFE divergence0