Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07600-AT5G48290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Heavy metal transport/detoxification superfamily protein
Function (paralog2):Heavy metal transport/detoxification superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.1677941805237
Log2 mRNA fold difference:2.0981788273547
Log2 TE fold difference:-0.040937198572023
Sequences
Protein sequence

MKQKILIRIAMTDDTTRAKAMKTAVQFKGVNAVEIKGDHRNQIEVTGVEVDMIALINTLR
KKVAFAELVSVAKVEPPKDGDKKPEEEKKPEEKKPEEKKPEEKKPEPCCQPWQKPEPCYQ
PWPHDGYGVPSSYPYPCDPYNQIGEPVYNQDPNCRIM

MKQKILIRVTMTDDKTRAKAMTKAVQFKGVSAVEIKGDHRNQIEVTGVEVDMIPLIQILR
KKVAFAELVSVTKVEPPKKEDEKKGGDGKGAEGKGGDQKGGDKKGPDDKEPPEPKPVPCY
PWPLQGYGVPSSFPHQGYGVPSTFPQGDGVPSSFPYPCHPAHPYNDIGEPVYNHEPNCKI
M

www.000webhost.com

Other information
Ka divergence:0.637618KaKs divergence:-0.999725
GC content 1 (%):44GC content 2 (%):48GC content divergence:0.043
Length 1 (bp):474Length 2 (bp):546Length divergence:0.071
MFE 1 (kcal):-115.81MFE 2 (kcal):-155MFE divergence0.145