Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07650-AT5G48250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CONSTANS-like 9
Function (paralog2):B-box type zinc finger protein with CCT domain

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.8880503691534
Log2 mRNA fold difference:1.0060765751217
Log2 TE fold difference:0.99981065041763
Sequences
Protein sequence

MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNAQPATVRC
VEERVSLCQNCDWSGHNNSNNNNSSSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCLD
LAGQSICEQELGMMNIDDDGPTDKKTCNEDKKDVLVGSSSIPETSSVPQGKSSSAKDVGM
CEDDFYGNLGMDEVDMALENYEELFGTAFNPSEELFGHGGIDSLFHKHQTAPEGGNSVQP
AGSNDSFMSSKTEPIICFASKPAHSNISFSGVTGESSAGDFQECGASSSIQLSGEPPWYP
PTLQDNNACSHSVTRNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAGEA
YDYDPLTPTRSY

MGYMCDFCGEQRSMVYCRSDAACLCLSCDRNVHSANALSKRHSRTLVCERCNAQPASVRC
SDERVSLCQNCDWSGHDGKNSTTTSHHKRQTINCYSGCPSSAELSSIWSFCMDLNISSAE
ESACEQGMGLMTIDEDGTGEKSGVQKINVEQPETSSAAQGMDHSSVPENSSMAKELGVCE
DDFNGNLISDEVDLALENYEELFGSAFNSSRYLFEHGGIGSLFEKDEAHEGSMQQPALSN
NASADSFMTCRTEPIICYSSKPAHSNISFSGITGESNAGDFQDCGASSMKQLSREPQPWC
HPTAQDIIASSHATTRNNAVMRYKEKKKARKFDKRVRYVSRKERADVRRRVKGRFVKSGE
AYDYDPMSPTRSY

www.000webhost.com

Other information
Ka divergence:0.352812KaKs divergence:0.322109
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1119Length 2 (bp):1122Length divergence:0.001
MFE 1 (kcal):-357.7MFE 2 (kcal):-325.62MFE divergence-0.047