Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07720-AT5G48180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactose oxidase/kelch repeat superfamily protein
Function (paralog2):nitrile specifier protein 5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.8928060900357
Log2 mRNA fold difference:0.18931734403544
Log2 TE fold difference:1.7287999013661
Sequences
Protein sequence

MAATPMEGKWVQLKQKGTGPGARSSHAIALVGNKMYAFGGEFQPRVPVDNQLYVFDLETQ
TWSIQEASGDAPPPRVGVAMAAVGPIIYFFGGRDSTHQELNELYCFNTLTNQWKLLSSGE
TGPQNRSYHSITADSQNVYVFGGCGVDGRLNDLWAYNVVDQKWIKFPSPGEACRGRGGPG
LEVVQGKIWVVYGFAGEEADDVHCFDIAKGEWKEVETKGEKPSARSVFSTAVVGKQILIS
GGEIDPSDLGHMGAGCFTGDAYGLDTETLEWRKWEDGVGSVEHPGPRGWCAFAAGSRDGK
QGLLVYGGNSPSNDRLDDIFFFTPNTLLK

MCPVENKWLKVGQKGAGPGARSSHAMTVVGNKVYCFGGELKPTIHIDNDLYVFDLETQEW
SIAPATGEAPFPCFGVSMVTIGSTIYVYGGRDDKRRYNGLHSYDTETNEWKLLAPVEEGL
PGRSYHSMAGDDRKVYVFGGVTAKGRVNTLHAYDVVDQKWVEYPAAGEACKGRGAPGLVV
VEGRIWVLFGFDGNELGDIHCFDLASEQWKAVETTGDVPAARSVFPAVSYGKYIVIYGGE
EEPHELMHMGAGKMSGEVYQLDTETLVWERIVCGNEEEKPSQRGWCAFTKAVKDGEEGLL
VHGGNSPTNERLDDLVFWGFSHLNVN

www.000webhost.com

Other information
Ka divergence:0.428765KaKs divergence:-0.629931
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):990Length 2 (bp):981Length divergence:-0.005
MFE 1 (kcal):-329.5MFE 2 (kcal):-322.5MFE divergence-0.011