Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G07780-AT5G48160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1423)
Function (paralog2):Protein of unknown function (DUF1423)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.2235979623866
Log2 mRNA fold difference:0.51609041063272
Log2 TE fold difference:-0.28241757178022
Sequences
Protein sequence

MGTSSGSNLPHQMLPPRQQLQTSLSLVSSDPHLSRSNSGIVRESPAESASSQETWPTSKS
IMGRKTDSGKTGPDSHDQHVIRHVSIADKVSLRDIARERLDIVAERMHRLPEEYLEELKN
GLKAILEGNGAQPIDEFMFLQKFVQTRSDLTSKTLVRAHRVQLEVLVVINTGIQAFLHPN
INLSQSSLIEIFVYKRCRNIACQNELPADGCPCEICANRKGFCNLCMCVICNKFDFAVNT
CRWIGCDVCSHWTHTDCAIRDGEISMGVSPKSVSGMGEMLFKCRACNHTSELLGWVKDVF
QHCAPNWDRESLMKELDFVSRIFRGSEDTRGRKLFWKCEELMEKIKGGLAEATAAKLILM
FFQEIELDSPKSLESGEGGGTIAPQDACNRIAEVVKETLRKMEIVGEEKTRMYKKARMGL
EECEREVEEKAKQVAELQMERQKKKQQIEEVERIVRLKQAEAEMFQLKANEAKVEAERLE
RIVKAKKEKTEEEYASNYLKLRLSEAEAEKEYLFEKIKEQESGGNGGEASQAVMYSKIRE
MLHGYNASSPRVDPRSNQRNPFRSNP

MGTSSGSNHPHQMLPPRQQQRSGGGLETALSLVSSDQEPRRESPAESASSQETWPLGDTV
AGKKSMSQKTEPDSMEQTVNVMHHVSNADKVSVRDIARERVELVAERMHRLPDEFLDELK
NGLKSILEGNVAQSVDEFMFLQKVVQSRTDLSSVTLVRAHRVQLEILVAINTGIQAFLHP
NISLSQPSLIEIFVYKRCRNIACQNQLPADDCYCDICTNRKGFCNLCMCTICNKFDFSVN
TCRWIGCDLCSHWTHTDCAIRDGQITTGSSAKNNTSGPGEIVFKCRACNRTSELLGWVKD
VFQHCAPNWDRESLMKELDFVSRIFRGSEDQRGRKLFWKCEELIDKIKGGLAEATAAKLI
LMFFQEIESDSAKSFENGEGGRLMAPQDACNRIAEVVQETLRKMEIVAEEKMRMFKKARM
ALETCDRELEDKAKEVSELKAERQKKKLQIDELERIVRLKQAEADMFQLKANEAKREADR
LQRIVLAKMDKSEEEYASNYLKQRLSEAEAEKQYLFEKIKLQENSRVASQSSGGGGDPSQ
VMMYSKIRDLLQGYNLSPKVDPQLNERNPFRSNP

www.000webhost.com

Other information
Ka divergence:-0.259281KaKs divergence:-0.433434
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1701Length 2 (bp):1725Length divergence:0.007
MFE 1 (kcal):-506.27MFE 2 (kcal):-528.8MFE divergence0.022