Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08570-AT3G08660
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Phototropic-responsive NPH3 family protein
Function (paralog2):Phototropic-responsive NPH3 family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.74080482663137
Log2 mRNA fold difference:-0.022281453949295
Log2 TE fold difference:-0.68363877405167
Sequences
Protein sequence

MGIISDNAQSHSSSSAPAPSIFSSSFATRIFSDVAGDITIVVDGESFLLHKFPLVARCGK
IRKMVAEMKESSSNLSHTELRDFPGGSKTFELAMKFCYGINFEITISNVVAIRCAAGYLE
MTEDFKEENLIARTETYLEQVAFRSLEKSVEVLCSCETLYPQDIAETAHIPDRCVEAIAV
NACREQLVLGLSRLNRGTESGELKRGDSPEWWIEDLSALRIDYYARVVSAMARTGLRSES
IITSLMHYAQESLKGIRNCKERTKLDSGTFENEQRNVLEAIVSLFPNDNVPLSFLFGMLR
VGITINVAISCRLELERRIAQQLETVSLDDLLIPVVRDGDSMYDVDTVHRILVCFLKKIE
EEEEYDEDCCYENETENLTGSMCHSSLLKVGRIMDAYLAEIAPDPCLSLHKFMALIEILP
DYARVMDDGLYRAIDMFLKGHPSLNEQECKSLCKFIDTQKLSQEACNHVAQNDRLPMQMV
VRVLYSEQLRMKNVMSGESGEGLLLSSQKHSSENPSRAVSPRDTYASLRRENRELKLEIS
RVRVRLTELEKEQILMKQGMMEKSGHGGTLLTSLSKGIGRISIFGGGPTEGKLRNANRKS
KSRLERKTVRSRPESMF

MGSDSTLSLPSSSPPCNNRSSVPPTFTTRIFSDVAGDIIVVVDGESFLLHKFPLVARSGK
MRKMVRDLKDSSSMIELRDFPGGPSTFELTMKFCYGINFDITAFNVVSLRCAAGYLEMTE
DYKEQNLIFRAENYLDQIVFRSFHESVLVLCSCETQEIAETYEIPDRCVEAIAMNACRKQ
LVSGLSEELKGRDCLEMWTEELSALGIDYYVQVVSAMARLSVRSESIVASLVHYAKTSLK
GIIDRNCQEQRKIVEAMVNLLPNDEKGSYSLSIIPLGFLFGMLKVGTIIDIEISCRLELE
RRIGHQLETASLDDLLIPSVQNEDSMYDVDTVHRILTFFLERIEEEDDECGYDSDSTGQH
SSLLKVGRIMDAYLVEIAPDPYLSLHKFTAIIETLPEHSRIVDDGIYRAIDMYLKAHPLL
TEEERKKLCNFIDCKKLSQEASNHVAQNDRLPVQMVVRVLYTEQLRLKKALSGDSEEGSW
VLPSGVQSRAVSPRDTYAALRRENRELKLEISRMRVRVSELEKEHNLMKHEMMEKSGNNG
GTFLTSLSKGIGRIATFGGETRQKVNRKSRSVSERKSSRSGR

www.000webhost.com

Other information
Ka divergence:0.204865KaKs divergence:-0.540216
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1854Length 2 (bp):1749Length divergence:-0.029
MFE 1 (kcal):-629.63MFE 2 (kcal):-533.05MFE divergence-0.083