Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08630-AT3G08640
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Protein of unknown function (DUF3411)
Function (paralog2):Protein of unknown function (DUF3411)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.9274400192851
Log2 mRNA fold difference:2.6824915123894
Log2 TE fold difference:0.25695777720325
Sequences
Protein sequence

MAAMAAKLHISTKSDQSNVRLPRLINLSRDPTARVLFPRNGSVSSLHTNFSSPNIMVPCA
GGGGGGSIGNHGGGSGSGGGGGGYGGSEEEESSPWGPLGLFIQGWRSRVAADSQFPFKVL
MEMLVGVSANVLGDMASRPNFGLNELDFVFSTLVVGSILNFTLMYLLAPSAISHGSSNLL
PGIFRSCPSSHMFEQGNFTLMNRFGTLVYKGMVFATVGLAAGLVGTAISNGLIMLRKKID
PSFETPNKPPPTLLNSLTWATHMGVSANVRYQTLNGAEFLLEKSLPPLVFKTSVIALRVV
NNVLGGMSFVTLARMTGSQSVEEEKKIEMSEISEKEKED

MAAMAAKLQLSAKSDQSSVRLPRVINLSRDPTTRVSFPRNGSVCSLHTNFSSPHLAKPCA
GGGGGGSTGNNGGGSGSGGGGGGFGGSGGEASEESSPWGPIGLFIQGWRSRVAADPQFPF
KVLMEEIVGLSACVLGDMASRPNFGLNELDFVFSTLVVGSILNFVLMYMLAPTAATLGSS
QTLPGIFRNCPSSHMFEQGSFTVMNRFGTLVYKGMVFASVGLAAGLVGTAISNGLIMLRK
KMDPSFETPNKPPPTVLNSLTWATHMGVSANARYQTLNGIEFLLAKVLPPLVFKTSVIVL
RCANNVAGGMSFVLLARMTGSQSVEEKTEISEKEKDD

www.000webhost.com

Other information
Ka divergence:-0.129016KaKs divergence:0.696945
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1020Length 2 (bp):1014Length divergence:-0.003
MFE 1 (kcal):-321.4MFE 2 (kcal):-332.5MFE divergence0.017