Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08850-AT5G01770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HEAT repeat ;WD domain, G-beta repeat protein protein
Function (paralog2):HEAT repeat ;WD domain, G-beta repeat protein protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0671146638757
Log2 mRNA fold difference:0.026504351756172
Log2 TE fold difference:-2.1593465641873
Sequences
Protein sequence

MALGDLMVSRFSQSSVSLVSNHRYDEDCVSSHDDGDSRRKDSEAKSSSSYGNGTTEGAAT
ATSMAYLPQTIVLCELRHDASEASAPLGTSEIVLVPKWRLKERMKTGCVALVLCLNITVD
PPDVIKISPCARIEAWIDPFSMAPPKALETIGKNLSTQYERWQPRARYKVQLDPTVDEVR
KLCLTCRKYAKTERVLFHYNGHGVPKPTANGEIWVFNKSYTQYIPLPISELDSWLKTPSI
YVFDCSAARMILNAFAELHDWGSSGSSGSSRDCILLAACDVHETLPQSVEFPADVFTSCL
TTPIKMALKWFCRRSLLKEIIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLP
HELFQRLFRQDLLVASLFRNFLLAERIMRSANCNPISHPMLPPTHQHHMWDAWDMAAEIC
LSQLPQLVLDPSTEFQPSPFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRFR
ALVLLGRFLDMGSWAVDLALSVGIFPYVLKLLQTTTNELRQILVFIWTKILALDKSCQID
LVKDGGHTYFIRFLDSSGAFPEQRAMAAFVLAVIVDGHRRGQEACLEANLIGVCLGHLEA
SRPSDPQPEPLFLQWLCLCLGKLWEDFMEAQIMGREANAFEKLAPLLSEPQPEVRAAAVF
ALGTLLDIGFDSNKSVVEDEFDDDEKIRAEDAIIKSLLDVVSDGSPLVRAEVAVALARFA
FGHKQHLKLAAASYWKPQSSSLLTSLPSIAKFHDPGSATIVSLHMSPLTRASTDSQPVAR
ESRISSSPLGSSGLMQGSPLSDDSSLHSDSGMMHDSVSNGAVHQPRLLDNAVYSQCVRAM
FALAKDPSPRIASLGRRVLSIIGIEQVVAKPSKPTGRPGEAATTSHTPLAGLARSSSWFD
MHAGNLPLSFRTPPVSPPRTNYLSGLRRVCSLEFRPHLLGSPDSGLADPLLGASGSERSL
LPLSTIYGWSCGHFSKPLLGGADASQEIAAKREEKEKFALEHIAKCQHSSISKLNNNPIA
NWDTRFETGTKTALLHPFSPIVVAADENERIRVWNYEEATLLNGFDNHDFPDKGISKLCL
INELDDSLLLVASCDGSVRIWKNYATKGKQKLVTGFSSIQGHKPGARDLNAVVDWQQQSG
YLYASGETSTVTLWDLEKEQLVRSVPSESECGVTALSASQVHGGQLAAGFADGSLRLYDV
RSPEPLVCATRPHQKVERVVGLSFQPGLDPAKVVSASQAGDIQFLDLRTTRDTYLTIDAH
RGSLTALAVHRHAPIIASGSAKQLIKVFSLQGEQLGIIRYYPSFMAQKIGSVSCLTFHPY
QVLLAAGAADSFVSIYTHDNSQAR

MALGDLMVSRLSQSSVTVVTNHLYDDDDNCASSAHDDSRVSIIASPRVASSSYENLSAAT
SMAYLPQTLVLCDLRHDDASDIVQPPRWRLKERMKTGCVALVMCLHITVDPPDVIKISPC
ARLECWIDPFSMFPPRRALEAIGQNLSIQYERWLARARYKVELDPTKDDVRKLCLSCRKY
AKTERVLFHYNGHGVPKPTPNGEIWVYNKNFTQYIPLPVSELDSWLKTPTIYVFDCSAAR
VILNAFAEGESSGPPKDCILLAACDVHETLPQSVEFPADVFTSCLTTPINIALKWFCRRS
LLKEFIDESLIDRIPGRQNDRKTLLGELNWIFTAVTDTIAWNVLPRELFQRLFRQDLLVA
SLFRNFLLAERIMRSGNCTPISHPMLPPTHQHHMWDAWDMAAEICLSQLPQFFLDPNTEF
QPSSFFTEQLTAFEVWLDHGSEHKKPPEQLPIVLQVLLSQCHRYRALVLLGRFLDMGPWA
VDLALSVGIYPCVVKLLQTTTIELRQILVFIWTKILALDKSCQVDLVKDRGHIYFIRFLD
SSDAFPEQRAMAAFILAVIVDGYKRGQESCLEANLIAVCLGHLEATQLCDPPPEPLFLQW
LCLCLGKLWEDYLEAQIMGREANASENLIAGHTNLLQVRAAAVFALGTLLDVGFDSGKGV
CDEEFDDDENIVEDIIIKSLLDVVSDGSPLVRTEVAVALARFAFGHKQHLKSVADSYWKP
QNSLRTSLPSMAKFHDSGTSIVASSDMGSLTRASPDSQPVAREGRISSSLQEPFSGLMQG
SPLADDSSLHSDVGIIHDGVSNGVVHQPRPLDNAIYSQSVLAMFTLAKDPSPRIASLGRR
VLSVIGIEQIVAKPSKSNGRPGEAASASHTPLAGLVRSSSWFDMHTGHLPLTFRTPPVSP
PQTSYLTGLRRVCSLELRPHLLGSPDSGLADPILGVSGSERSLLPQSTIYNWSCGHFSKP
LLGGADANEEIAAQREEKKKFSLEHIAKCQHSSISGLSNIPIANWDTKFETGTKTALLHP
FSPIVVAADENERIRVWNYEEATLLNGFDNNDFPDKGISNLCLVNELDDSLLLVASCNVP
TLSRASFAIRIWKDYATKGRQKLVTGFSSIQGQKPGASGLNAVVDWQQQSGYLYVSGESL
SIMVWDLDKEQLVKSMPFESGCSVTALSASQVHGSQLAAGFADGSVRLYDVRTPDFLVCA
TRPHQRVEKVVGLSFQPGLDPAKIVSASQAGDIQFLDLRRPKETYLTIDAHRGSLTALGV
HRHAPIIASGSAKQLIKVFSLKGEQLGIIKYHTSFMGQQIGPVSCLAFHPYQMLLAAGAA
GSFVSLYTHHNTQLPR

www.000webhost.com

Other information
Ka divergence:0.325154KaKs divergence:0.251584
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):4035Length 2 (bp):4011Length divergence:-0.003
MFE 1 (kcal):-1320.05MFE 2 (kcal):-1270.63MFE divergence-0.019