Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08870-AT5G01560
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Concanavalin A-like lectin protein kinase family protein
Function (paralog2):lectin receptor kinase a4.3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.085229482721234
Log2 mRNA fold difference:-0.7245355774992
Log2 TE fold difference:0.43269038178176
Sequences
Protein sequence

MGIARSINSFMFFFFLMILSNASKSSVLAEATTAKFTFIGFKENQTDIQTEGASTIQHDN
DLLRLTNRKQNVTGTAFYRKPIRLRELTNSSDIKVCSFSTSFVFVILPSSPGNGGFGFTF
TLSPTPNRPGAESAQYLGLLNRTNNGNPSNHVFAVEFDTVQGFKDGADRRGNHIGLNFNN
LSSNVQEPLIYYDTEDRKEDFQLESGEPIRVLIDYDGSSETLNVTIYPTRLEFKPKKPLI
SRRVSELSEIVKDEMYVGFTAATGKDQSSAHYVMGWSFSSCGENPMADWLEISRLPPPPR
LSNKKGYNSQVIVLIVALSIVTLVLLVLLFIFVMYKRRIQEEDTLEDWEIDYPHRFRYRD
LYLATKKFKESEIIGTGGFGIVYRGNLSSSGPIAVKKITSNSLQGVREFMAEIESLGRLG
HKNLVNLQGWCKHKNELLLIYDYIPNGSLDSLLYQTPRRNGIVLPWDVRFEIIKGIASGL
LYLHEEWEQIVVHRDVKPSNVLIDEDMNAKLGDFGLARLYERGTLTQTTKIVGTLGYMAP
ELTRNGKGSTASDVFAFGVLLLEIVCGNKPTNAENFFLADWVMEFHTNGGILCVVDQNLG
SSFNGREAKLALVVGLLCCHQKPKFRPSMRMVLRYLNGEENVPQIDENWGFSDSSRDDHK
SNVVGYVSSDRASSSNTFSSFSNVSSSSIVSGR

MGRAKSMVSLLLVLFLVRAHVATTETTTEFIFHGFKGNQSEIHMQGDSTITSNGLLRLTD
RNSDVVGTAFYHKPVRLLDSNSTNTTVRSFSTSFIFIIPSSSTSNGGFGFTFTLSPTPNR
TDADPEQYMGLLNERNDGNSSNHVFAVEFDTVQGFKDGTNRIGNHIGLNFNSLSSDVQEP
VAYFNNNDSQKEEFQLVSGEPIQVFLDYHGPTKTLNLTVYPTRLGYKPRIPLISREVPKL
SDIVVDEMFVGFTAATGRHGQSSAHYVMGWSFASGGEHPLAAMLDISQLPPPPPNKAKKR
GYNGKVIALIVALSTVISIMLVLLFLFMMYKKRMQQEEILEDWEIDHPHRFRYRDLYKAT
EGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHKNL
VNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGAVLSWNARFQIAKGIASGLLYLH
EEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLYERGSQSCTTVVVGTIGYMAPELAR
NGNSSSASDVFAFGVLLLEIVSGRKPTDSGTFFIADWVMELQASGEILSAIDPRLGSGYD
EGEARLALAVGLLCCHHKPESRPLMRMVLRYLNRDEDVPEIHDNWGYSDSSRTDLGSKLV
GYISSDRASSSHSHTSSSLTRISSTSLISGR

Other information
Ka divergence:0.131305KaKs divergence:0.14195
GC content 1 (%):43GC content 2 (%):47GC content divergence:0.044
Length 1 (bp):2082Length 2 (bp):2076Length divergence:-0.001
MFE 1 (kcal):-609.78MFE 2 (kcal):-651.3MFE divergence0.033