Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08880-AT5G01570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-7.4571779480104
Log2 mRNA fold difference:-7.415097965045
Log2 TE fold difference:-2.9031080120508
Sequences
Protein sequence

MGNASENFDIEDLMSYGDDLINLLNVKNGFDIISQSSEQFKALNFACHEDFNQIQGSIED
CKTKLYACKKKTEEAYSDIAAEDEIERLQKELDEEMEREFKLKDELRLVADELKDLNAQL
SSIDEHKQSTKRKVRDDLRAEKKLSMYASVTNVIPDIDDPSKISGYMVDREKRLIEKFQF
ETNKMTAYETCNSIWSIINKQ

MRDQSRNFEMVISWGDELIHVLDDRKGFDVLVQTLEQLRAIPFSCDEDFKEIHESLQDLQ
KKLDVCKEKTDEANSEIADEEEIERLQKELDEELELECKLKEELRYEALFEEHRLAIKRN
KRDQLRTETKLPMYASVTRVIPNIDDSLKTSGYMVGRDKRLMDKFEFDSNKSTSVYETCN
ERIGEEQILTVIGIANLGTVT

www.000webhost.com

Other information
Ka divergence:-0.11003KaKs divergence:-0.999735
GC content 1 (%):38GC content 2 (%):41GC content divergence:0.038
Length 1 (bp):606Length 2 (bp):606Length divergence:0
MFE 1 (kcal):-155.4MFE 2 (kcal):-152.3MFE divergence-0.01