Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08890-AT5G01610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF538
Function (paralog2):Protein of unknown function, DUF538

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.8282668202271
Log2 mRNA fold difference:-1.3162230274814
Log2 TE fold difference:-0.42784348453437
Sequences
Protein sequence

MDQILNKVGSYWLGKKANKQLDSVGDDINSLSSSIEGGTKWLVNKIKGKMQKPLPELLKE
FGLPVGIFPRDATNYEFNEQTRKLTVFIPSICEVGYKDTSVLRFTTTVTGFLEKGKLADV
EGMKTKVMIWVKVTSISADSSKVHFTAGMKKSRSRDAYEVLRDGVEIDKF

MDQIFNKVGSYWLGQKANKQFDSVGNDLNSVSTSIEGGTKWLVNKIKGKMQKPLPELLKE
YDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKFTTTVTGHLEKGKLTDV
EGIKTKVMIWVKVTSISTDASKVYFTAGMKKSRSRDAYEVQRNGLRVDKF

Other information
Ka divergence:0.42918KaKs divergence:0.700046
GC content 1 (%):42GC content 2 (%):41GC content divergence:-0.012
Length 1 (bp):513Length 2 (bp):513Length divergence:0
MFE 1 (kcal):-135.72MFE 2 (kcal):-122.9MFE divergence-0.05