Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08910-AT5G01390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ heat shock family protein
Function (paralog2):DNAJ heat shock family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.2782349186437
Log2 mRNA fold difference:0.28649300978956
Log2 TE fold difference:-0.56525428710144
Sequences
Protein sequence

MGVDYYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDP
QKRAIYDQYGEEGLTSQAPPPGAGGGFSDGGASFRFNGRSADDIFSEFFGFTRPFGDSRG
AGPSNGFRFAEDVFSSNVVPPRKAAPIERQLPCSLEDLYKGVSKKMKISRDVLDSSGRPT
TVEEILTIEIKPGWKKGTKITFPEKGNEQRGIIPSDLVFIVDEKPHAVFKRDGNDLVMTQ
KIPLVEALTGYTAQVSTLDGRSVTVPINNVISPSYEEVVKGEGMPIPKDPSKKGNLRIKF
TVKFPSRLTTEQKSGIKRMFSSS

MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYDVLSDP
QKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSADDIFSEFFGFTRPSFGT
GSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQLPCSLEDLYKGVSKKMK
ISRDVLDSSGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEHRGVIPSDLVFIVDEKPHP
VFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPVNNVISPSYEEVVKGEGMPIP
KDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRMLSP

www.000webhost.com

Other information
Ka divergence:0.315379KaKs divergence:-0.093913
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):972Length 2 (bp):1008Length divergence:0.018
MFE 1 (kcal):-314.8MFE 2 (kcal):-322.65MFE divergence0.012