Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08930-AT5G01460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LMBR1-like membrane protein
Function (paralog2):LMBR1-like membrane protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.2571773579017
Log2 mRNA fold difference:-1.5347007121754
Log2 TE fold difference:1.2993804265645
Sequences
Protein sequence

MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML
PADVANRHACRHAIYNGACNLTLPMKDLWLAIYIVDAILVFFVIPFAMFFYEGDQDKTLG
KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHLASATSTFPTSWQFSNTQPCIGN
TARQCSAFTANPTSEKTWTMRTTFPEYVVALATIVGSVLFTIFGGVGIACLPLGLITAFI
RRPKAVITRSQYIKEATELGKKARELKKAADGLHQEERSGAKGRKWRKNVKAVEKELLQL
EEDVNLLEEMYPQGEQAETAWAFTVLGYLAKFILGIVGLIVSIAWVAHIIIYLLVDPPLS
PFLNEVFIKLDDVWGLLGTAAFAFFCFYLLLAVIAGAMMLGLKLVFITIHPMKWGATLMN
SFLFNVGLILLCSISVIQFCATAFGYYAQATAAQEIFGHTLQSLRGIKYLYKYNVFQIGF
VILAGLTFLYYIAFGWRRKKTSGRFQLSS

MGDFNLALVIVAIVVCVIVFISSIYLLVNYQHPDDANQAYFPKFVVVFGLSIAMISILML
PADVANRHACRHSIYNGACNLTLPMKDLWLAVYIVDAVLVFFIIPFAMFFYEGDQDKALG
KRIKSALIWVVTTAVVCALVLGILYGVIGKVDFSVRHLSSATTTFPTSWQFSNNQPCIGN
TARQCSAYTANAASEKTWSMRTTFPEYVVALATIVGSVLFTIFGGVGIACLPLGLITAFI
RRPKAVITRSQYIKEATELGKKARDLKKAADALHQEERSGAKGRKWRKNVKAVEKELLQL
EEDVNLLEEMYPQGEQAETAWAFTVLGYLAKFVLGILGLIVSVAWIAHIIIYLLVDPPLS
PFLNEVFIKLDDVWGLLGTAAFAFFCFYLLLAVIAGAMMLGLKLVFITIHPMKWGATLMN
SFLFNVGLILLCSISVIQFCATAFGYYAQATAAQEIFGHTLQSLRGIKYLYKYNVFQIGF
VVLAGLTFLYYIAFGWRRKKPSGRFQLST

www.000webhost.com

Other information
Ka divergence:-0.157736KaKs divergence:-0.3137
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1530Length 2 (bp):1530Length divergence:0
MFE 1 (kcal):-434.2MFE 2 (kcal):-445.99MFE divergence0.013