Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08940-AT5G01530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):light harvesting complex photosystem II
Function (paralog2):light harvesting complex photosystem II

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.63015242682116
Log2 mRNA fold difference:0.13582870518076
Log2 TE fold difference:0.50471374907912
Sequences
Protein sequence

MAATSTAAAASSIMGTRVVSDISSNSSRFTARFGFGTKKASPKKAKTVISDRPLWFPGAK
SPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTP
FQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDGSSYLGQP
LPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLASDPVKKAQLQLAEI
KHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS

MAATSAAAAAASSIMGTRVAPGIHPGSGRFTAVFGFGKKKAAPKKSAKKTVTTDRPLWYP
GAISPDWLDGSLVGDYGFDPFGLGKPAEYLQFDIDSLDQNLAKNLAGDVIGTRTEAADAK
STPFQPYSEVFGIQRFRECELIHGRWAMLATLGALSVEWLTGVTWQDAGKVELVDGSSYL
GQPLPFSISTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKTAQLQL
AEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS

www.000webhost.com

Other information
Ka divergence:-0.156544KaKs divergence:0.0873239
GC content 1 (%):51GC content 2 (%):54GC content divergence:0.029
Length 1 (bp):864Length 2 (bp):873Length divergence:0.005
MFE 1 (kcal):-291.24MFE 2 (kcal):-316.5MFE divergence0.042