Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G08943-AT3G08947
Species:Arabidopsis
Duplication type:TD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.89606623389405
Log2 mRNA fold difference:-0.31907089835203
Log2 TE fold difference:-0.46793805873087
Sequences
Protein sequence

MAMEITQFLLAAQSADARVRTEAEASLRQFQEQNLPLFLLSLSFELENNDKPAESRRLAG
ILLKNSLDAKDSATKDHLVKQWFAIDVALKSQIKDRLLRTLGSSALEARHTSAQVIAKVA
SIEIPQKQWPELVGSLLNNMTQQGSPAHLKQSTLETLGYVCEEISHHDLVQDEVNSVLTA
VVQGMNQSENTAEVRLAATKALLNALDFSQTNFENEMERNYIMKMVCETACSKEAEIRQA
AFECLVSIASTYYEVLEHYIQTLFELTSNAVKGDEESVALQAIEFWSSICDEEIDRQEYD
SPDSGDSSPPHSCFIEKALPHLVQMLLETLLKQEEDQDHDDDVWNISMAGGTCLGLVART
VGDGVVPLVMPFVEKNISSPDWRSREAATYAFGSILEGPTIDKLAPMVAAGLEFLLNATK
DQNNHVRDTTAWTLSRIFEFLPSPDSGFSVISPENLPRIVSVLLESIKDVPNVAEKVCGA
IYNLAQGYEDSGASSSLLSPYLTEIITHLLAAAERTDGAESKLRGAAYETLNEVVRCSNL
SEASSIIAHLLPAIMKKLAETMDLPIISTDDREKQAELQASLCGVLQVIIQKLSSRDDMK
PIIVQNADDIMRLFLRVFGCHSSSVHEEAMLAIGALAYATGTEFVKYMPELFKYLQMGLQ
NFEEYQVCSITVGVIGDICRALDEKILPFCDQIMGLLIQNLQSGALHRSVKPPIFSCFGD
IALAIGAHFERYVAPAVQIMQGAAQVCAQMDTLDEELMDYANQLRRSIFEAYSGILQGFK
DAKAELMMPYAQHLLQFVELVSKDSLRDESVTKAAVAAMGDLADVVGENTKQLFQNFTFC
DEFLNECLESEDEDLKVTARWTQGMIARLVL

MAMEITQFLLAAQSADARVRTEAEGNLRQFQEQNLPLFLVSLSFELANNDKPAESRRLAG
ILLKNSLDAKDSATKDHLVKQWFAIDVALKSQIKDRLLRTLGSSALEARHTSAQVIAKVA
SIEIPQKQWPELVGSLLNNMTQQGSPAHLKQSTLETLGYVCEEISHHDLVQDEVNSVLTA
VVQGMNQSENTAEVRLAATKALCNALDFSQTNFENEMERNYIMKMVCETACSKEAEIRQA
AFECLVSIASTYYEVLEHYIQTLFELTSNAVKGDEESVSLQAIEFWSSICDEEIDRQEYD
SPASGDSSPPHSSFIEKALPHLVQMLLETLLKQEEDQDHDDDVWNISMAGGTCLGLVART
VGDHVVPLVMPFVEKNISSPDWRCREAATYAFGSILEGPTIDKLAPMVAAGLEFLLNATK
DQNNHVRDTTAWTLSRIFEFLHSPDSGFSVISPENLPRIVSVLLESIKDVPNVAEKVCGA
IYNLAQGYEDSGASSSLLSPYLTEIITHLLAAAERTDGAESKLRGAAYETLNEVVRCSNL
SEASSIIAHLLPAIMKKLAETMDLPIISTDDREKQAEVQASLCGVLQVIIQKLSGREDTK
PIIMQSADDIMRLFLRVFGCHSSSVHEEAMLAIGALAYATGAEFVKYMPELFKYLQMGLQ
NFEEYQVCSITVGVLGDICRALDEKILPFCDQIMGLLIQNLQSGALHRSVKPPIFSCFGD
IALAIGAHFERYVAPAVQIMQGAAQVCAQMDTLDEELMDYANQLRRSIFEAYSGILQGFK
DTKAELMMPYAQHLLQFVELVSKDPLRDESVTKAAVAAMGDLADVVGENTKQLFQNFTFF
GEFLNECLESEDEDLKVTARWTQGMIARLMHPS

Other information
Ka divergence:0.0185634KaKs divergence:0.368202
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2616Length 2 (bp):2622Length divergence:0.001
MFE 1 (kcal):-858.4MFE 2 (kcal):-865.49MFE divergence0.004