Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09020-AT5G01250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha 1,4-glycosyltransferase family protein
Function (paralog2):alpha 1,4-glycosyltransferase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.4450886395574
Log2 mRNA fold difference:0.35403758457161
Log2 TE fold difference:-0.47320891324308
Sequences
Protein sequence

MDHDITTKVRAMFDHRRLNRSGSSLFTAFASTVIALVVFTIVLVSNLSVREDFSAKVVTI
EIKTIVPYLPLSSEKEVSDQVNNNYSIKQQITVKEEINKLQVLEVFGGKDVSEKFQQRAT
EFLRDDCEVKFMMTWISPAELFGKREILSVESVFKSHARGCLMILSSTMDSLQGFRILKP
FLDRGYRVMAVTPDLPFLLKDTAGESWLEEIQTGKRDPGKISLAQNLSNLMRLAYLFKFG
GVYLDTDMIVLKSFKTLRNVIGAQTLEPVSRNWTRLNNAVLIFDKNHPFLLKSIEEFALT
FNGNVWGHNGPYLVSRVARAVEGTDGYNFTILTPPAFYPVNWVEIEKLFKVPRTEKDSKR
VQVKVLEMQKRSYGLHLWNKFSRKFEIEQGSAMDKLVSNQCIICDSVVSVS

MDRHDIEKRFTVVIDNRRLNQSGSSSLFTAFAISFVTLIVVTTFTLISNFSMQPHRDFSG
VKIEIKRVIPHLPLSSEREGERSDLLKQQTQVNEKLQVIEVFSGDNLSDKFQKRVNEFVG
DGCEVNFVMTWISPADFFGNREVLAIESVFKSHPYGCLMILSATMDSPQGYATLKPFIDR
GYKVLAVTPDLPFLLKGTAGELWLDEIKSGKRDPGKISLAQNLSNLMRLAYLYKYGGVYL
DTDMIVLKSFKGLRNVIGAQTLDPSSTNWTRLNNAVLIFDKNHPLLLKFMEEFAKTFNGN
IWGYNGPYLVSRVARAVEGSSGYNFTVMRPSVFYSVNWLEIKKLFKVPKTEKDSKWVKTK
LLHMQRNGYGLHLWNKFSRKYEIEQGSAMWKLVSEHCIICEISSVSS

www.000webhost.com

Other information
Ka divergence:-0.11691KaKs divergence:-0.318417
GC content 1 (%):41GC content 2 (%):40GC content divergence:-0.012
Length 1 (bp):1236Length 2 (bp):1224Length divergence:-0.005
MFE 1 (kcal):-362.2MFE 2 (kcal):-356.8MFE divergence-0.008