Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09070-AT5G01170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF740)
Function (paralog2):Protein of unknown function (DUF740)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.726370249818
Log2 mRNA fold difference:-0.56434908236222
Log2 TE fold difference:-1.1510078241748
Sequences
Protein sequence

MNPATDPVSAAAAALAPPPQPPQPHRLSTSCNRHPEERFTGFCPSCLCERLSVLDQTNNG
GSSSSSKKPPTISAAALKALFKPSGNNGVGGVNTNGNGRVKPGFFPELRRTKSFSASKNN
EGFSGVFEPQRRSCDVRLRSSLWNLFSQDEQRNLPSNVTGGEIDVEPRKSSVAEPVLEVN
DEGEAESDDEELEEEEEEDYVEAGDFEILNDSGELMREKSDEIVEVREEIEEAVKPTKGL
SEEELKPIKDYIDLDSQTKKPSVRRSFWSAASVFSKKLQKWRQNQKMKKRRNGGDHRPGS
ARLPVEKPIGRQLRDTQSEIADYGYGRRSCDTDPRFSLDAGRFSLDAGRFSVDIGRISLD
DPRYSFDEPRASWDGSLIGRTMFPPAARAPPPPSMLSVVEDAPPPVHRHVTRADMQFPVE
EPAPPPPVVNQTNGVSDPVIIPGGSIQTRDYYTDSSSRRRKSLDRSSSSMRKTAAAVVAD
MDEPKLSVSSAISIDAYSGSLRDNNNYAVETADNGSFREPAMMIGDRKVNSNDNNKKSRR
WGKWSILGLIYRKSVNKYEEEEEEEEDRYRRLNGGMVERSLSESWPELRNGGGGGGGPRM
VRSNSNVSWRSSGGGSARKVNGLDRRNKSSRYSPKNGENGMLKFYLPHMKASRRMSGTGG
AGGGGGGGWANSHGHSIARSVMRLY

MNLSADQAPVTAVDELAPPSQPHRLSTSCDLHPEERFSGFCPSCLCDRLSVLDHNAAPPP
SSSSRKPPSISAVSLKALFKPSSSGTNNSNGNGRVRPGFFPELRRTKSFSAKNNEGFSGG
FEPQRRSCDVRLRDDERNLPINEAASVDKIEEEARESSVSEIVLEVTEEAEIEEDEENGE
KDPGEIVEEKSSEIGEEEEELKPMKDYMDLYSQTKKPSVKDFAGSFFSAASVFSKKLQKW
KQKQKVKKPRNGVGGGRPQSEIGVGRRSSDTDPRFSLDAGRFSVDIGRISMDDSRYSLDE
PRASWDGHLIGRTTAARVPLPPSMLSVVENAPLNRSDMQIPSSPSIKPISGDSDPIIIIP
GGSNQTRDYYTGPPSSRRRKSLDRSNSIRKIVTELEDVKSVSNSTTTIDSNSMETAENKG
NQNGDKKSRRWGKWSILGFIYRKGKDDEEEDRYSRSNSAGMVERSLSESWPEMRNGEGGG
PKMRRSNSNVSWRSSGGGSARNKSSRYSSKDGENGMLRFYLTPMRRSWKTSGGSGGGGGG
GGGGGWEKTAAKANSHGHSIARRVMRLY

www.000webhost.com

Other information
Ka divergence:0.146024KaKs divergence:0.384843
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):2058Length 2 (bp):1707Length divergence:-0.093
MFE 1 (kcal):-754.82MFE 2 (kcal):-610.64MFE divergence-0.106