Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09100-AT5G01290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mRNA capping enzyme family protein
Function (paralog2):mRNA capping enzyme family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.106859710091
Log2 mRNA fold difference:-0.84394148226826
Log2 TE fold difference:-0.22710917320748
Sequences
Protein sequence

MVATMDLNASPQPEEDDEPYVRHLEDYSSRDERIESAVEIARREREERKKRMRYDKPTHN
SQPVFRDQYYQNRNTKAYDRYKIPQGWLDCPPSGNEIGFLVPSKVPLNESYNNHVPPGSR
YSFKQVIHNQRIAGRKLGLVIDLTNTTRYYSTTDLKKEGIKHVKIACKGRDAVPDNVSVN
AFVNEVNQFVLNLKHSKKYILVHCTHGHNRTGFMIVHYLMRSGPMNVTQALKIFSDARPP
GIYKPDYIDALYSFYHEIKPESVICPSTPEWKRSTELDLNGEALPDDEDDDGGPAGPVQG
FQEESHQVDVKMSNDDVLGDEIPPDQEEGYRQFFYRMLSLNIGGRGCSQFPGSHPVSLNR
ENLQLLRQRYYYATWKADGTRYMMLLTTDGCYIVDRSFRFRRVQMRFPFRHPTEGISDKV
HHFTLLDGEMIIDTLPDKQKQERRYLIYDMVAINGQSVVERPFYERWKMLEKEVIDPRNH
EKARSHIYRYDLEPFRVRRKDFWLLSAVEKVLKGFIPSLSHEADGLIFQGWDDPYVPRTH
EGLLKWKYPEMNSVDFLYEQDESGRGMLSLFERGKKKHMDGNSVVFRDDSDPAEYSGKIV
ECSWDQDEKVWVSMRVRVDKSTPNDINTFRKVMRSIKDNITEEVLLQEIREIIRLPMYAD
RIQMDSKAARRR

MDLNASPQPEEDDEPFKRRHEDRMESAVEIARREREERKKRMRFDRPTRVSQPAFRDQYR
DTRVYDQSKLPQGWLDCPGFGLEIGCIIPSKVPLSESYNEHVPPGKRYSFKQVVRNQRIN
GRKLGLVIDLTNTTRYYPTLDLKKDGIKHVKIACRGRDAVPDNVSVNTFVNEVLQFVLNQ
KHAKKYVLVHCTHGHNRTGFMIVHYLMRSMPTMNVTQALKLFSDARPPGIYKPDYIDALY
TFYHEIKPESVTCPPTPEWKRSAELDLNGEAVQDDDDDDSPPDPVQEINQENVKMSNDDT
LGDEIPHYQEEAYRQFCYKMLMMNVGGRGFMQFPGSHPVSLDRESLQLLRQRYYYATWKA
DGTRYMMLLTIDGCYLIDRSFKFRRVQMRFPCKHSREGISDKVHHYTLLDGEMVIDTPTG
EQGEARRRYLVYDMVAINGESVVERTFCERWNMFVREVIGPRAAEKLRSHCYRYDLEPFA
VRMKGFWLLSTVEKLLKNTIPSLSHEADGLIFQGWDDPYVPRTHKGLLKWKYAEMNSVDF
LYEMGEEEGRGFLFLHERGKKKLMEGYSVEFRDDSDPSSYNGKIVECAWDKDKKVWFSMR
IRVDKTTPNDINTARKVIKSINDNITEEVLLQEIREIIRLPMYADRIRNDSQAARRR

Other information
Ka divergence:0.196836KaKs divergence:-0.0463749
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2019Length 2 (bp):1974Length divergence:-0.011
MFE 1 (kcal):-607MFE 2 (kcal):-579.51MFE divergence-0.023