Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09240-AT5G01060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase protein with tetratricopeptide repeat domain
Function (paralog2):Protein kinase protein with tetratricopeptide repeat domain

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.040484967929514
Log2 mRNA fold difference:-0.85563339711396
Log2 TE fold difference:0.84043917265519
Sequences
Protein sequence

MIERTNLIVLAADNKEEDEGSTCPNFLEFSLEQLRVATDGFSADNIVSEHNERVPNIVYK
GQLNDGRKIAVKRFQRLSWPDSLEFIEEAQAVGRCRSEHMANLIGCCSEGHERLLVAEYM
PNETLAKHLFHWEKRPMKWEMRLRVALHTATALEYCNDWGIDLYHDLNTYRILFDKVGNP
RLSCFGLMKCSREGKSYSTNLAFAPPEYLRLGTVIPESVTFSFGTLLLDLMSGRHIPPNH
ALDLFRGKNYLVLMDSALDGQFSDEDRTELIHLASRCLRPEPDERPSIKFLMSALSRLEK
RAELWPNVKEENIPTPSYTEPATKEPLPLTPFGEACWRVDLSGMHELLEKLGYGEDDVVV
TNEFSFQMWTGQMQENMDYKKHGDAAFRAKDFETAIEFYTEFMSGAPVVSPTVLARRCLC
YLMSDMFREALSDAMQTQVASPEFSIALYLQAACLLKLGMEAEAKEALRHGSSLEAF

MGCICFKSWRRSSSSPSITSTVIDDLENVREYDADDDGGHYPLIFREFSLEQLRIATDGF
SAGNIVSEHNDSVPNIVYKGKLGDGRRIAVKRFQRLSWPDPFEFINEAQAVGRLRSEHMA
NLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLKVALHTARALEYCNDKGI
DLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAFAPPEYLRLGTVIAESVTF
SFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQFSDEDRTELIHVASRCFKTE
PEERPSIKFLKATLSRLQKRAKLCPINVKRPMSPPSKNLPEKTKPATESLKLTPFGDACS
RADLSSIHELLEKLGYEEDNGVGNEFSFQMWTGEMQENMDYKKHGDAAFLAKDFDTAIEF
YTEFMTGAPTVSPTVLARRCLCYLMTEMFSEALSDAMQAQVASPEWPIPLYLQAACLFKL
EMEAEAKEALRHGSALEAY

www.000webhost.com

Other information
Ka divergence:0.220494KaKs divergence:0.00948429
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1434Length 2 (bp):1500Length divergence:0.022
MFE 1 (kcal):-443.09MFE 2 (kcal):-450.86MFE divergence0.009