Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09300-AT5G02100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):OSBP(oxysterol binding protein)-related protein 3B
Function (paralog2):Oxysterol-binding family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0942343872146
Log2 mRNA fold difference:-1.6778352231269
Log2 TE fold difference:-0.37264901902723
Sequences
Protein sequence

MAPNDPKKAVGGGGSGFFASLASSISNLGSAMTKSVNGLVPYEGLEVINPEGSTDDAEEE
ASRGRWKQEDRDGYWKMMQKYIGSDVTSMVTLPVIIFEPMTMLQKMAELMEYSHLLDMAD
KTEDPYLRMVYASSWAISVYYAFQRTWKPFNPILGETYEMANYNGVNFISEQVSHHPPMS
AGHAENEHFTYDCTSKLKTKFLGNSIDVYPVGRTRVTLKRDGVVLDLVPPLTKVHNLIFG
RTWVDSPGEMIMTNQTTGDKVVLYFQPCGWFGSGRYEVDGYVYNASEEPKILMTGKWNES
MSYQPCDGEGEPLPGTELKEVWKLADVPKDDKYQYTHFAHKINSFDTAPKKLLPSDSRLR
PDRYALEMGDMSKSGYEKSSMEERQRAEKRTREEKGQAFTPKWFDVTEEVTATPWGDLEV
YQFNGKYSEHRAAADNSEDNTDPKSIQFNPWQFQDLST

MASNDPKNGGGFFASLASSITNFGSAMSKSVNGLMGYEGLEVINPEGSTDDAEEEAGRGR
WKQEERDGYWKMMQKYIGSDVTSMVTLPVIIFEPMTMLQKMAELMEYSYLLDMADKTEDP
YMRMVYASSWAISVYYAYQRTWKPFNPILGETYEMTNHNGINFIAEQVCHHPPMSAGHAE
NEHFAYDCTSKLKTKFLGNSIDVYPVGRTRVTLKRDGVVLDLVPPLTKVHNLIFGRTWVD
SPGEMVMTNLTTGDKVVLYFQPCGWFGSGRYEVDGYVYNSAEEPKMLMTGKWNESLSYQP
CDAEGEPLPGTELKEVWKVAEAPKNDKYQYTHFAHKINSFDTAPKKLLSSDSRLRPDRYA
LEMGDMSKSGFEKSSLEDRQRAEKKSREEKGQKFAPKWFDETEEVTPTPWGDLEVYQFNG
KYSVHRATAENSEDTTDVKLTQFNPWQFQDLSA

Other information
Ka divergence:0.0512936KaKs divergence:0.0416995
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1377Length 2 (bp):1362Length divergence:-0.005
MFE 1 (kcal):-420.16MFE 2 (kcal):-387.12MFE divergence-0.041