Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09350-AT5G02150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Fes1A
Function (paralog2):Fes1C

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.7008014979376
Log2 mRNA fold difference:-1.2902249794607
Log2 TE fold difference:-0.37622000594791
Sequences
Protein sequence

MAKDGPNWDGLLKWSLSHADGTRPTRQLSEEDRKWFMEAMQSQTVDVVKRMKEITLVMQT
PEQVLVEHGVTPEDIQDLLDELQEHVESIDMANDLHSIGGLVPLLSFLKNSHANIRAKAA
DVVSTIVQNNPRSQELVMETNALESLLSNFTSDTDIHARTQALGAISSLIRHNKPGVTAF
KLANGYAGLRDALASDSVRFQRKALNLLQYLLQEDDSDRSIATGLGFPRVMMHLASSDDA
EIREAALRGLLELSREKNDGSSSIDKSDEKLRQLLEERIKGITLMSQEDLETVKEERQLV
DLLWSICYNEPSSLREKGLVVLPGEDALPPDVASKLFEPPLRASAANRNATEKKDEPMKL
LGP

MAKDGPNWDGLLKWSLSHSDGTRPTCQLSEEDRKWFAEAMQSQTVDVVKRLKEITQVLQT
PQQVLEAHEVTPQDIEGLLDELQEHVESIDMANDLHSVGGLVPLLGYLKNSNANIRAKSA
DVVSTIVENNPRSQESVMEANGLESLLLRFTSDTDMHSRTQALGAISSLIRNNKPGITGF
RIANGYSGLKDALETDSVRFQRKALNLLHYLLQENDSDSDIAIEFGLHHLMMHLVSSFDA
DVREAALRGLLELVKARKDCSTCGSSIVKGDERLRQILKDRIKAISRVKAMSLFMSQEDL
SAAKEERQLLDSLWTTIFNEPSSL

www.000webhost.com

Other information
Ka divergence:0.419538KaKs divergence:0.616835
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1092Length 2 (bp):975Length divergence:-0.057
MFE 1 (kcal):-326.89MFE 2 (kcal):-289.95MFE divergence-0.06