Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09370-AT5G02320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 3r-3
Function (paralog2):myb domain protein 3r-5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.3237327932
Log2 mRNA fold difference:3.8146203003206
Log2 TE fold difference:-1.090546993792
Sequences
Protein sequence

MSSTFNPAASSPDEMMDLQEETGEVKIEDQCVENKQSTPASCSSVSEGSAGSSHKSPTIA
SPATVSPTHRYLGRTSGPIRRAKGGWTPEEDETLRQAVDTFKGKSWKNIAKSFPDRTEVQ
CLHRWQKVLNPDLIKGPWTHEEDEKIVELVEKYGPAKWSIIAQSLPGRIGKQCRERWHNH
LNPDINKDAWTTEEEVALMNAHRSHGNKWAEIAKVLPGRTDNAIKNHWNSSLKKKSEFYL
LTGRLPPPTTTRNGVPDSVTKRSSSAQKRVFGSVAQTSSVTTDVNNLAEDGNGQINSSVP
VEEVVAASRMTSLNEYARSPQLPNPEPLPENGGAANNGYHLYYTPQIDYYRASEVDTQRM
YGNECGCSPSASPVSFFTPPPCRNVHSNGSTPRSPESYLREAGRTYPNTPSIFRKRRPRV
VVQDNNNAKKTDEAKEVDQKVNDGKDSSEIQNNGSNAYNLSPPYRIRSKRTAVFKSRQLE
FISREEEKADDETKSSEKDMLIDGDSQLLG

MSSSSNPPVCSPEKEERSEMKIEIQCMENKQPLAASCSSASEGSGCFFLKSPEIATPATV
SSFPRRTSGPMRRAKGGWTPEEDETLRRAVEKYKGKRWKKIAEFFPERTEVQCLHRWQKV
LNPELVKGPWTQEEDDKIVELVKKYGPAKWSVIAKSLPGRIGKQCRERWHNHLNPGIRKD
AWTVEEESALMNSHRMYGNKWAEIAKVLPGRTDNAIKNHWNSSLKKKLEFYLATGNLPPP
ASKFIVLKDIADGDRDSKQSSATKPFKDSDSLTQTSSGNTDSNEVGRDHFDSSSALLEEV
AASRRIGVNEYACSPVEYKPQLPNLEPISEEVRINSKAYFERSIQRKVENGFGTPKHGNL
YYKSPLDYYFPSEADLQHMYGYECGCSPGAASPVSLMTTPCNKDSGLTATRSPESFLREA
ARTFPNTPSIFRKRRKVVLAAKTDAVVVVNGVVKEVDRKEESKDMRKSLLLETTDNCSDD
EELGLNGNAFNLSPPYRLRAKRTAVIKSRQLEFTSEKEKQPDNEIEFTSAKEKQPDNEIK
TSEEDKPV

www.000webhost.com

Other information
Ka divergence:-0.0402381KaKs divergence:-0.48481
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1533Length 2 (bp):1647Length divergence:0.036
MFE 1 (kcal):-433.61MFE 2 (kcal):-472.5MFE divergence0.043