Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09390-AT5G02380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):metallothionein 2A
Function (paralog2):metallothionein 2B

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.9756101195266
Log2 mRNA fold difference:5.1329080674067
Log2 TE fold difference:-1.1549251008127
Sequences
Protein sequence

MSCCGGNCGCGSGCKCGNGCGGCKMYPDLGFSGETTTTETFVLGVAPAMKNQYEASGESN
NAENDACKCGSDCKCDPCTCK

MSCCGGSCGCGSACKCGNGCGGCKRYPDLENTATETLVLGVAPAMNSQYEASGETFVAEN
DACKCGSDCKCNPCTCK

www.000webhost.com

Other information
Ka divergence:0.474476KaKs divergence:0.999876
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):246Length 2 (bp):234Length divergence:-0.025
MFE 1 (kcal):-84.59MFE 2 (kcal):-84.5MFE divergence-0.001