Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09500-AT5G02610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal L29 family protein
Function (paralog2):Ribosomal L29 family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.79091726558574
Log2 mRNA fold difference:-1.3512362915773
Log2 TE fold difference:0.5580037304748
Sequences
Protein sequence

MARIKVHELREKSKSDLQNQLKELKAELALLRVAKVTGGAPNKLSKIKVVRKSIAQVLTV
SSQKQKSALREAYKNKKLLPLDLRPKKTRAIRRRLTKHQASLKTEREKKKEMYFPIRKYA
IKV

MARIKVHELRDKSKTDLQNQLKEFKAELALLRVAKVTGGAPNKLSKIRMDVDLAYDSNMY
LRSIKFGPCIKVVRKSIAQVLTVISQKQKSALREAYKNKKLLPLDLRPKKTRAIRRRLTK
HQASLKTEREKKKEMYFPVRKYAIKV

www.000webhost.com

Other information
Ka divergence:0.124729KaKs divergence:0.999954
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):372Length 2 (bp):441Length divergence:0.085
MFE 1 (kcal):-111.9MFE 2 (kcal):-125.61MFE divergence0.058