Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09570-AT5G02630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Lung seven transmembrane receptor family protein
Function (paralog2):Lung seven transmembrane receptor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.6162335278387
Log2 mRNA fold difference:-0.20067895533819
Log2 TE fold difference:-2.469815792325
Sequences
Protein sequence

MTRLPLFVVLLLFSASCITRTAAEIKSLTISDDSRPMILFEKFGFTQSGHVSVSISSVAV
VSSSSDPIPDPSRLGFFLMSEESLLQVVLEIEQNPNFCVLDSNYVLHLFTFHDLSPPPGS
KYEHLYPVMSPNEYSLFFVNCVPETKISMKVRTEMYNLDPNGSKDYLPAGSTRLPGLYFF
FSLGYLAFLGLWGYACWVNKRVVHRIHVLMAALLLMKALNLICAAEDKHYVKVTGTPHGW
DVLFYIFQFIRVVLLFTVIVLIGTGWSFLKPFLQEKEKNVLMVVVPLQVLANIASIVIGE
TGPFIKDWVTWNQIFLLVDIVCCCAILFPIVWSIRSLRETSKTDGKAARNLAKLTLFRQF
YIVVIGYLYFTRIVVFALKTIAAYKYRWVSNAAEEIASLAFYMLMFYMFRPVEKNEYFVI
DEEEEEAAELALKEDDFEL

MTILPFLAAVFVLQLLSTLTVAEIKSFTISNDSRPVILLEKFGIIEIGHVTVSVSSVSVL
SPILDSSKLGFFVLSEESLPHVLLELQQNFSFCVLDSHYILHFFTFVDLSPPPRSQFSKS
YPITSPNDYSLFFANCVPETRVSMKVHTEIYHDLYPNGSRDYLLAGSAQLPGLYLVFFLC
YLSFLCFWLCFCWNHKQIVKRIHLLMTALLLVKSLTLICAAVYKHYVKVTGTAHGWNIVF
YIFQFISVVLLFMVIVLIGNGWSFLKPKLHVKEKKLLVIVVPLQVLANIASIVIGETGPY
TQDWVSWNQIFFLADITCCCAIVFAMVWSMCCLRETSKTDGKAVKNLAKLPVLRKFYVLV
IGYLFFTRIVVVVMKMKADFTYQWVSNAAEEIATLSFYCLMFYMFRPIEKNEYCDVDDEE
EIVELSLK

Other information
Ka divergence:0.528025KaKs divergence:0.688643
GC content 1 (%):45GC content 2 (%):41GC content divergence:-0.047
Length 1 (bp):1320Length 2 (bp):1287Length divergence:-0.013
MFE 1 (kcal):-391.67MFE 2 (kcal):-345.99MFE divergence-0.062