Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09600-AT5G02840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):LHY/CCA1-like 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.6406588132384
Log2 mRNA fold difference:1.3605061577916
Log2 TE fold difference:0.26442782198357
Sequences
Protein sequence

MSSSPSRNPTNAEAPPPPPTSTDAVAEGSSKKVRKPYTITKSRESWTEEEHDKFLEALQL
FDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGTLAHVPPPRPKRKAAHPYPQKASKN
AQMPLQVSTSFTTTRNGDMPGYASWDDASMLLNRVISPQHELATLRGAEADIGSKGLLNV
SSPSTSGMGSSSRTVSGSEIVRKAKQPPVLHGVPDFAEVYNFIGSVFDPETRGHVEKLKE
MDPINFETVLLLMRNLTVNLSNPDLESTRKVLLSYDNVTTELPSVVSLVKNSTSDKSA

MTSTNPVVAEVIPAETSTDATETTIATTEAGEAPEKKVRKAYTITKSRESWTEGEHDKFL
EALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGTLAHVPPPRPKRKAAHPYPQ
KASKNAQMSLHVSMSFPTQINNLPGYTPWDDDTSALLNIAVSGVIPPEDELDTLCGAEVD
VGSNDMISETSPSASGIGSSSRTLSDSKGLRLAKQAPSMHGLPDFAEVYNFIGSVFDPDS
KGRMKKLKEMDPINFETVLLLMRNLTVNLSNPDFEPTSEYVDAAEEGHEHLSS

www.000webhost.com

Other information
Ka divergence:0.337764KaKs divergence:0.469843
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):897Length 2 (bp):882Length divergence:-0.008
MFE 1 (kcal):-249.4MFE 2 (kcal):-237.4MFE divergence-0.025