Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09670-AT5G02950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tudor/PWWP/MBT superfamily protein
Function (paralog2):Tudor/PWWP/MBT superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.7905252727628
Log2 mRNA fold difference:-1.1044552939055
Log2 TE fold difference:-0.58974000834797
Sequences
Protein sequence

MSTESERIESVSEANASSLEVGNDQMSEALAGQAQELKTIGDDKEGCGNFASAGDNGMEK
VNGFTNLVKETESVNGELDLGTRTENVGGESNQSDKKVLVDSEEVMMVEKRGLLVEKEVE
PDMVCSHGADLSDVKVSDGRLDSEDLVQDRKPDGLEKQGTKVEDLDVVCFMGLEPHESKD
ESILDDEIAHVAAKVKISDSDLVWAKVRSHPWWPGQVFDASAATDKAKKHFKKGSFLVTY
FGDCTFAWNEASRIKPFRQHFSQMAKQSSLPDFIDAIDFALEEVSRRIEFGLACSCISEE
VYQKIKTQNVINPGIREDSSSIHGGDKVSSAVFFEPANLVGYVKRLACSPSYDATDALQL
VSQRAQLLAFNRWKGYTDLPEFMTLQGSVESAPKISPAEEQSSLVEVSDPEPTKSKQVYT
KRRKTNLQTEQSSLVEVSDPDKGDCKHDGVFEYEETIVPKKKEKTLAEFIAEKRVSRHNG
NTSHEKSGNVPHCEKKRKVVQSKVPKSTKKIKANLQTEDPGSPVSPKNDRKNNLSAGDKI
TPQKARKSFGIGASILKVANQMHCSTPTRLLPCSDSTSKKAAKSNGSGKSLQEKPKAEAL
SAREISPSTTLSSPHAASVTKTTSGKSNSVSLDHNLSGELDQVRKEAPSTNLVEDPMLES
RDLKDSSKEQVVHEDKKEAANVADEKSIMDSNLTGEKISGLDLREQPSNKNCSGGSDSCK
EDVSAE

MSTEPEGVESDSNADFAINASSFDYGMAHTSETLADPMSFQAQDLVVNLTGVERKVFVSA
RDDKDSLCNGVDFDADSDLLKNKDKKGFSKENLKLFDSDLVWAKLRSYPWWPGLVFDKSV
ASKAAMRHFKKGNVLVAYFGDCTFAWNNASQIKPFHQNFSQMQEQSNSAEFRDAIDCALD
EVSRRVEFGLSCSCVSEEAYNKLKTQNIINAGIREDSSVRYGGDKLSDGISFEPAKLVDY
MKHLACFPCYDATEKLQFVINRAQVLAFQQWKDYSHFIDYETFVRSVESAATLASLPEVN
MDEGISAKKRKTDYKDNAEQTKEKTLSDLTVKKRCGSRSTEKLDGKSHSEKKRKVESSES
GKSEKRIKKSQQKEDSVSKHSNEESLLSVGDTNKLQKTAEPCHGTGVENEMNSLTPTLKP
CRASKSTEVENEKTKKPRHQELAERKISSPDEMLSSLHAANTSTGIPDSINIDPSNYEDF
EKFINELFCSKLNGDSKKASITETSEPCDKKDSAEEEILPANKEITGSGSKEQIGLKDCS
ADSLPPYALVLNFADSGSVPSEEKLNEIFKRYGPLHESKTKVTMKGKRAKVVFKRGEDAK
TAFSSAGKYSIFGPSLLSYRLEYVCPKRKKTT

www.000webhost.com

Other information
Ka divergence:0.0319559KaKs divergence:-0.0309951
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):2181Length 2 (bp):1899Length divergence:-0.069
MFE 1 (kcal):-631.35MFE 2 (kcal):-564.58MFE divergence-0.056