Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09680-AT5G02960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein S12/S23 family protein
Function (paralog2):Ribosomal protein S12/S23 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.1310771888447
Log2 mRNA fold difference:3.5666746729432
Log2 TE fold difference:0.55796779471141
Sequences
Protein sequence

MGKTRGMGAGRKLKQLRITQRWADKHYKKSNRGNEWKKPFACSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS

MGKTRGMGAGRKLKRLRINQRWADKQYKKSHLGNEWKKPFAGSSHAKGIVLEKIGIEAKQ
PNSAIRKCARVQLIKNGKKIAAFVPNDGCLNYIEENDEVLIAGFGRKGHAVGDIPGVRFK
VVKVSGVSLLALFKEKKEKPRS

Other information
Ka divergence:-1KaKs divergence:-0.996711
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):429Length 2 (bp):429Length divergence:0
MFE 1 (kcal):-133.7MFE 2 (kcal):-129MFE divergence-0.018