Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09690-AT5G02970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.39513889859421
Log2 mRNA fold difference:0.21161163769375
Log2 TE fold difference:-0.62451578962256
Sequences
Protein sequence

MEEMRRGVPTWQDELASLMDGGLQYDGSPIDLTADTESRSKSSGFESGSGSESVESLKDQ
VTGFMKSWGEMLMDLAIGCKDVVQQMVVTDDSFVVRKLRKPAAKVSKKLSFLNEYLPEDR
DPVHAWPVIFFVFLLALTALSFSSDHDRSVPLLKKIRLHPTSASRVQLPDGRYLAYQELG
VSADRARHSLIVPHSFLSSRLAGIPGVKESLLKDYGVRLVSYDLPGFGESDPHRARNLSS
SASDMIDLAAALGIVDKFWLLGYSSGSVHAWAAMRYFPDQIAGVAMVAPMINPYEPSMTK
EEMAKTWEQWQRKRKFMYFLARRWPSLLPFSYRRSFLSGNLEPLDKWMSVSLGEKDKLVT
ADPVFEDLYQRNVEESVRQGTAKPFVEEAALQVSNWGFSLPEFHMQKKCRTNGVLSWLMS
MYSESECELIGFRKPIHIWQGMDDRVTPPSVTDYISRVIPEATVHRLPNEGHFSYFYLCD
ECHTQIFSAIFGEPKGPVELLEQRTETHRPDQPKTGLSDSSSLPKSK

MEEIRGVPTWQEELASLVDAGLRYDGAPIDLTAATKRSGFVSADGSGSEPKETLKDQVTG
FMKSWGEMLLELAKGCKDIVQQTVVTDDSFLVRKLRKPAAKVSKKLSFLNEFLPEDRDPI
HAWPVIFFVFLLALAALSFSPENDRPVTVITKLRLHPTGATRVQLPDGRYIAYQELGVSA
ERARYSLVMPHSFLSSRLAGIPGVKKSLLVEYGVRLVSYDLPGFGESDPHRGRNLSSSAS
DMINLAAAIGIDEKFWLLGYSTGSIHTWAGMKYFPEKIAGAAMVAPVINPYEPSMVKEEV
VKTWEQWLTKRKFMYFLARRFPILLPFFYRRSFLSGNLDQLDQWMALSLGEKDKLLIKDP
TFQEVYQRNVEESVRQGITKPFVEEAVLQVSNWGFTLSEFRTQKKCATNGVLSWLMSMYS
EAECELIGFRKPIHIWQGMEDRVAPPSMSDYISRMIPEATVHKIRNEGHFSFFYFCDECH
RQIFYALFGEPKGQLERVKETEDTVVETEAHKDT

www.000webhost.com

Other information
Ka divergence:-0.011587KaKs divergence:0.284837
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1584Length 2 (bp):1545Length divergence:-0.012
MFE 1 (kcal):-500.5MFE 2 (kcal):-481.14MFE divergence-0.02