Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09700-AT5G03030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Chaperone DnaJ-domain superfamily protein
Function (paralog2):Chaperone DnaJ-domain superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.9851365977531
Log2 mRNA fold difference:1.2815863305072
Log2 TE fold difference:0.71933222953682
Sequences
Protein sequence

MVAAIIAGAAVAAAAYAGKYGIEAWQAFKLRPVRPRMRKFYEGGFQATMNRREAALILGV
RESVAAEKVKEAHRRVMVANHPDAGGSHYLASKINEAKDMMLGKTKNSGSAF

MATPMIAGAAVAAAAVAGRYGILAWQAFKARPRVPRMRRFYEGGFQSSMTRREAALILGV
RESVVADKVKEAHRRVMVANHPDAGGSHYLASKINEAKDMMLGKSNNSGSAF

www.000webhost.com

Other information
Ka divergence:-0.692086KaKs divergence:-0.999946
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):339Length 2 (bp):339Length divergence:0
MFE 1 (kcal):-108.8MFE 2 (kcal):-113.9MFE divergence0.023