Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09710-AT5G03040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):IQ-domain 1
Function (paralog2):IQ-domain 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.2523547175309
Log2 mRNA fold difference:1.6892423889773
Log2 TE fold difference:1.4728927776385
Sequences
Protein sequence

MVKKAKWLKNVKKAFSPDSKKLKHESVECQDSVISYPVLIATSRSSSPQFEVRVDEVNYE
QKKNLYPPSSDSVTATVAHVLVDSPPSSPESVHQAIVVNRFAGKSKEEAAAILIQSTFRG
HLARRESQVMRGQERLKLLMEGSVVQRQAAITLKCMQTLSRVQSQIRSRRIRMSEENQAR
HKQLLQKHAKELGGLKLFMRLFKFIVVSSDNGGNWNYSNQSKEQVEAGMLHKYEATMRRE
RALAYAFTHQQNLKSFSKTANPMFMDPSNPTWGWSWLERWMAGRPWESSEKEQNTTNNDN
SSVKNSTNRNSQGGETAKSSNRNKLNSSTKPNTPSASSTATRNPRKKRPIPSSIKSKSSD
DEAKSSERNRRPSIARPSVSDDETLSSSTARRSSNLIPTTKSARGKPKSQTSSRVAVTTS
TTEESSILPEKAPAKKRLSTSASPAPKPRRSSAPPKVEKGVLKAERTP

MGKKAKWFSSVKKAFSPDSKKSKQKLAEGQNGVISNPPVVDNVRQSSSSPPPALAPREVR
VAEVIVERNRDLSPPSTADAVNVTATDVPVVPSSSAPGVVRRATPTRFAGKSNEEAAAIL
IQTIFRGYLARRALRAMRGLVRLKLLMEGSVVKRQAANTLKCMQTLSRVQSQIRARRIRM
SEENQARQKQLLQKHAKELAGLKNGDNWNDSIQSKEKVEANLLSKYEATMRRERALAYSY
SHQQNWKNNSKSGNPMFMDPSNPTWGWSWLERWMAGRPLESSEKEQSNSNNDNAASVKGS
INRNEAAKSLTRNGSTQPNTPSSARGTPRNKNSFFSPPTPSRLNQSSRKSNDDDSKSTIS
VLSERNRRHSIAGSSVRDDESLAGSPALPSYMVPTKSARARLKPQSPLGGTTQENEGFTD
KASAKKRLSYPTSPALPKPRRFSAPPKVESGGVTVTNGAGS

www.000webhost.com

Other information
Ka divergence:-0.390605KaKs divergence:-0.156282
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1407Length 2 (bp):1386Length divergence:-0.008
MFE 1 (kcal):-410.45MFE 2 (kcal):-431.65MFE divergence0.025