Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09760-AT5G03180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.5865364294264
Log2 mRNA fold difference:-0.97018839672151
Log2 TE fold difference:-0.50929586415392
Sequences
Protein sequence

MMDDKARKEEEHHVSHQHNHSPLQRDGNSAEIAQGQELSSPGRDLWRRGLVLDLPSTTPE
DTTRDDLFRRNASLTSSPVAKRVNFSPMSSPRVGQRGASLSPSSSTSSSSRNKPNSLKNL
IPKLSFKNRNSNNDNVDIEKAADLGFVSSPSSGNGRDRSTWTLTNILTPRLKKTESLPVT
PIAHSNPESTHGRFAVDLVTSTKKGPPLPIHRSRSVPAFNKDGSQRQLGVFRVIPTPNMS
PTRNTIKLNDANVDGAEDVPEEEAVCRICLVELGEDSEAFKMECLCRGELALAHKECTIK
WFTIKGNRTCDVCKQEVQNLPVTLLRMQNSRGSIGAPDAEAAHYSLWQDVPILVIVSMLA
YFCFLEQLLLTKMQSGAIAVSLPFSCVLGLFASMTATTMVPKRYVWIYATTQFGLVVFFS
HIFFTLVRMQPVVAILLATIVGFGLTMSGTTGIVEFSKWRRSNRTAELPSSSQVDQPLVE
TTDQNISGSRN

MVMDDKDKYREVVEHWSCEGTSPALMVGDSTEITEMLSPSQHQRWRGLVLDIQSREAHGD
FLRANGSLIHSPVSKRFKFSPMSSPRTGRRVGSMSPSSSRNRTNQKNFKNRNHSADIEEG
VVSPLGDGSDKSYIPRTWSLTNLLAPRKSKKTESFITHSNPESMNGRYAVEVDPVTSMKG
ERLLPIRRTRSVPTFFNKDGSVKPSSVFRVIPTPSRGDEKRLEMTQASKLSKLHDENDDG
GEDVPEEEAVCRICMVEMEEDEEAFKMECMCKGELALAHKTCTIKWFTIKGNITCDVCKQ
EVRNLPVTLLRVQDSQNRSRAARDIEISRFNNVWQDIPILVIVSMLAYFCFLEQLLIIDM
KSSAVAIALPFSCIIGLLASMISTTMVKKNYVWIYATVQFGFVVLFAQLFYRVVRFDVKQ
PVMCIVLATMIGFGLTMTGTTAINEYLKWRRSNSHLPEEPASTQVV

Other information
Ka divergence:0.234087KaKs divergence:-0.204139
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1476Length 2 (bp):1401Length divergence:-0.026
MFE 1 (kcal):-420.72MFE 2 (kcal):-410.1MFE divergence-0.013