Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09770-AT5G03200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.0956799045961
Log2 mRNA fold difference:-1.417586262228
Log2 TE fold difference:-0.5978320755468
Sequences
Protein sequence

MGNISSSGGEGRRRRRRNHTAAPPPPPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPN
PNPVYQYPASYYHHPPPGAMPLPPYDHHLQHHPPHPYHNHSWAPVAMARYPYAGHMMAQP
TPYVEHQKAVTIRNDVNLKKESLRLEPDPDNPGRFLVSFTFDATVSGRISVIFFAKESED
CKLTATKEDILPPITLDFEKGLGQKFKQSSGSGIDFSVFEDVELFKAAADTEIYPLAVKA
EAAPSGGENEEEERSGSKNAQITQAVYEKDKGEIKIRVVKQILWVNGTRYELQEIYGIGN
TVEGDDDSADDANDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQP
VERLLEIKVHGNNGSGNNTGQGETVEQE

MGNLISLIFCCGRRQRSNIPPAMETAPLELPPNRFVFAAVPPYLNPNPNYVDQYPGNCLP
PPVTEPPMLPYNFNHLHHYPPNSYQLPHPLFHGGRYPILPPPTYVHQKAVTIRNDVNLKK
KTLTLIPDPENPNRLLVSFTFDASMPGRITVVFFATEDAECNLRATKEDTLPPITFDFGE
GLGQKFIQSSGTGIDLTAFKDSELFKEVDTDVFPLAVKAEATPAEEGKSGSTNVQITQVV
YTKEKGEIKIEVVKQILWVNKRRYELLEIYGIENTVDGSDEGKECVVCLSEPRDTTVLPC
RHMCMCSGCAKALRFQTNLCPVCRQPVEMLLEINKNG

www.000webhost.com

Other information
Ka divergence:0.415038KaKs divergence:0.616558
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1167Length 2 (bp):1014Length divergence:-0.07
MFE 1 (kcal):-348.93MFE 2 (kcal):-309.5MFE divergence-0.06