Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09810-AT5G03290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):isocitrate dehydrogenase VI
Function (paralog2):isocitrate dehydrogenase V

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.8511983952053
Log2 mRNA fold difference:0.99963537418634
Log2 TE fold difference:0.51953152342245
Sequences
Protein sequence

MTMTAFLARRLIGNGSSQILGTSSSSSGPFISVSRAFFSSSTPIKATLFPGDGIGPEIAE
SVKQVFTAADVVIDWDEQFVGTEVDPRTNSFLTWDNLQSVLKNKVGLKGPMATPIGKGHR
SLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEHQVVKGVVESL
KIITRKASMRVAEYAFLYAKTHGRKKVSAIHKANIMQKTDGLFLQCCDEVAAKYPEIYYE
KVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSMNIGEDGIALAEA
VHGSAPDIAGMNLANPTALLLSGVMMLRHLKLNKQAEQIHSAIINTIAEGKYRTADLGGS
STTTDFTKAICDHL

MTMAANLARRLIGNRSTQILGAVNSSSGAASSVARAFCSSTTPITATLFPGDGIGPEIAE
SVKKVFTTAGVPIEWEEHYVGTEIDPRTQSFLTWESLESVRRNKVGLKGPMATPIGKGHR
SLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEYSGLEHQVVRGVVESL
KIITRQASLRVAEYAFLYAKTHGRERVSAIHKANIMQKTDGLFLKCCREVAEKYPEITYE
EVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGLTPSCNIGEDGVALAEA
VHGSAPDIAGKNLANPTALLLSGVMMLRHLKFNEQAEQIHSAIINTIAEGKYRTADLGGS
STTTEFTKAICDHL

www.000webhost.com

Other information
Ka divergence:-0.548992KaKs divergence:-0.116974
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):1125Length 2 (bp):1125Length divergence:0
MFE 1 (kcal):-350.06MFE 2 (kcal):-349.96MFE divergence0