Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09820-AT5G03300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):adenosine kinase 1
Function (paralog2):adenosine kinase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.2684424373801
Log2 mRNA fold difference:-1.4071175097024
Log2 TE fold difference:0.10343531327189
Sequences
Protein sequence

MASSDFDGILLGMGNPLLDVSAVVDQQFLDKYDIKLNNAILAEDKHLPMYDEMSQKFNVE
YIAGGATQNSIKVAQWMLQVPGATSYMGSIGKDKYGEAMKKDATAAGVYVHYYEDEATPT
GTCGVCVLGGERSLIANLSAANCYKVEHLKKPENWALVEKAKFYYIAGFFLTVSPESIQL
VREHAAANNKVFTMNLSAPFICEFFKDVQEKCLPYMDYIFGNETEARTFSRVHGWETDDV
EQIAIKMSQLPKASGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGDA
FVGGFLSQLVHGKGIEECVRAGCYASNVVIQRSGCTYPEKPDFN

MASSSNYDGILLGMGNPLLDISAVVDDEFLTKYDIKLNNAILAEDKHLPMYDEMSSKFNV
EYIAGGATQNSIKVAQWMLQIPGATSYMGSIGKDKYGEAMKKDATAAGVNVHYYEDESAP
TGTCGVCVVGGERSLIANLSAANCYKVDHLKKPENWALVEKAKFYYIAGFFLTVSPESIQ
LVSEHAAANNKVFTMNLSAPFICEFFKDVQEKFLPYMDFVFGNETEARTFSRVHGWETED
VEQIAIKISQLPKATGTYKRTTVITQGADPVVVAEDGKVKKYPVIPLPKEKLVDTNGAGD
AFVGGFMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPEKPDFN

Other information
Ka divergence:-0.0763861KaKs divergence:-0.113196
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1035Length 2 (bp):1038Length divergence:0.001
MFE 1 (kcal):-341.3MFE 2 (kcal):-337.72MFE divergence-0.005