Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09830-AT5G03320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.2940651162572
Log2 mRNA fold difference:1.6021452357574
Log2 TE fold difference:-0.32336812877711
Sequences
Protein sequence

MKCFLFSGGDKRGEQKTPISVSLTSIFSDREINRSGSEFNSRDVSGTSTESSMGRKNSYP
PVSTRASNLREFSITDLKSATKNFSRSVMIGEGGFGCVFRGTVRNLEDSSVKIEVAVKQL
GKRGLQGHKEWVTEVNFLGIVEHTNLVKLLGYCAEDDERGIQRLLVYEYMPNRSVEFHLS
PRSLTVLTWDLRLRIAQDAARGLTYLHEEMEFQIIFRDFKSSNILLDEDWKAKLSDFGLA
RLGPSEGLTHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFLYELITGRRPVDRNRP
KGEQKLLEWVRPYLSDTRKFKLILDPRLEGKYPIKSVQKLAVVANRCLVRNSKARPKMSE
VLEMVNKIVEASSGNGSPQLVPLNSVKASRDARGKNNGGGGEGGWFGKLWNPKTIRAC

MKCFLFPLGDKKDEQRSPKPVSPTSNFSDVNKSGSDFSPRDVSGTSTVSSTGRNSNTSMS
ARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKR
GLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRS
PTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLG
PSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGE
QKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLE
MVTKIVEASSPGNGGKKPQLVPLKSQETSRVEEGKNKKVLDGAEGGWLEKLWNPKNVRAC

www.000webhost.com

Other information
Ka divergence:0.212535KaKs divergence:0.383459
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1257Length 2 (bp):1263Length divergence:0.002
MFE 1 (kcal):-422.72MFE 2 (kcal):-407.79MFE divergence-0.018