Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09880-AT5G03470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein phosphatase 2A regulatory B subunit family protein
Function (paralog2):Protein phosphatase 2A regulatory B subunit family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.38596465446976
Log2 mRNA fold difference:-1.3052737647991
Log2 TE fold difference:0.91200725800575
Sequences
Protein sequence

MFKKIMKGGHRKPSKSEANEPSSYGIGLPDNRSGPGSNVVVSHASRGALVNSSPSPVTAT
PPPPPLGSVEPLPLFRDVPVSERQTLFLRKLQNCCFLFDFTDTIKNARDKEIKRQTLLEL
VDFIQSGSSKISESCQEEMIKMISVNIFRSLPPASHENTGQEPADPEEEEPYLEPSWPHL
QLVYELLLRYVVSTDTDTKVAKRYIDHSFVLKLLDLFDSEDPREREYLKTILHRIYGKFM
VHRPFIRKAINNIFYRFIYETERHSGIGELLEILGSIINGFALPMKEEHKLFLIRVLIPL
HKPKPIVVYHQQLSYCIVQFVEKDYKLADTVIRGLLKYWPVTNCSKENLFLGELEEVLEA
TQPVEFQRCMVPLFQQIGRCLTSSHFQVAERALFLWNNEHIVGLIAQNRSVILPIIYPTL
EKNIQSHWNQAVHGLTTNIKKMFMEMDPELFEECQRQYEEKQAKSKEVEEQRQYTWKRLA
EAAAERDGGGGEEDHMITS

MFKKIMKGANRKASKAEANDSSMYGFDPPGRSGPGSNMIVNHASRGSLVPSSPNSMAAAT
TQPPPMYSVEPLPLFRDVSVSERQSLFLRKLQICCFQFDFTDTLKNAREKEIKRQTLLEL
VDFIQSGAGKLTEVCQEEMVKMISVNIFRCLPPASHENTGQEPADLEEEEPYLEPSWPHL
QLIYELLLRYIVPSDTDTKVAKRYIDHSFVLRLLELFETEDPREREYLKTILHRIYGKFM
VHRPFIRKAMNHIFYRFIYETERHSGIGELLEILGSIINGFALPMKEEHKLFLIRALIPL
HKPKPIAMYHQQLSYCIVQFVEKDYKLADTVIRGLLKFWPVTNCTKEVLFLGELEEVLEA
TQTVEFQRCMVPLFQQIARCLSSSNFQVAERALFLWNNEHVVGLIAQNRGVILPIIFASL
EKNIESHWNQAVHGLSANIKRMFMEMDPELFEECQQQYEEKQAKSKQVEEQRQNRWRRLD
EAVEEREREDPMITS

www.000webhost.com

Other information
Ka divergence:0.262453KaKs divergence:-0.0800201
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1500Length 2 (bp):1488Length divergence:-0.004
MFE 1 (kcal):-457.11MFE 2 (kcal):-447.9MFE divergence-0.01