Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09910-AT5G03530
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RAB GTPase homolog C2B
Function (paralog2):RAB GTPase homolog C2A

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.9739115820412
Log2 mRNA fold difference:1.9361481416277
Log2 TE fold difference:0.037026780756584
Sequences
Protein sequence

MGSSSGQSGYDLSFKILLIGDSGVGKSSLLLSFISSSVEDLAPTIGVDFKIKQMKVRGKR
LKLTIWDTAGQEKFRTLTSSYFRGSQGIILVYDVTKRETFLNLADIWAKEIELYSTNHDC
IKMLVGNKVDRESERKVSREEGMALAKDLNCLFHECSARTRENVNGCFEELALKIMEVPS
LLEEGSSSVKRKPDYRAHQGRCCSS

MGSSSGQSGYDLSFKILLIGDSGVGKSSLLVSFISSSVEDLAPTIGVDFKIKQLTVGGKR
LKLTIWDTAGQERFRTLTSSYYRGAQGIILVYDVTRRETFTNLVDVWGKEIELYSTNQEC
VRMLVGNKVDRESERGVSREEGIALAKELNCMFLECSARTRQNVEQCFEELALKIMEVPS
LLEEGSSAVKRNILKQKPEHQTNTQSGCCS

www.000webhost.com

Other information
Ka divergence:-0.297161KaKs divergence:0.028115
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):618Length 2 (bp):633Length divergence:0.012
MFE 1 (kcal):-174.2MFE 2 (kcal):-186.86MFE divergence0.035