Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09940-AT5G03630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):monodehydroascorbate reductase
Function (paralog2):Pyridine nucleotide-disulphide oxidoreductase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.961783900974
Log2 mRNA fold difference:1.9293592012676
Log2 TE fold difference:-0.1191734478671
Sequences
Protein sequence

MAEEKSYKYVIIGGGVAGGYAAREFSNQGLKPGELAIISKEPVPPFERPELTKVYIDLEV
NPTLANIYVCAGTGEAKQYPNWYKEKGIDLIVGTEIVKADLASKTLVSDDGKIYKYQTLL
IATGSTNIRLSEIGVQEADVKNIFYLREIEDSDELALAMELYVQRGKAVIIGGGFLGLEI
SSALRANNHEVTMVFPEPWLVHRFFTAEIASFYESYYANKGIKIIKGTVATGFSTNSDGE
VTEVKLEDGRTLEANIVVAGVGARPATSLFKGQLEEEKGGIKTDGFFKTSVPDVYALGDV
ATFPMKMYGGTRRVEHADNARKSAAQAVKAIKAGEEGKTIPDYDYLPYFYSRFFKLSWEF
YGENVGESVLFGDNDPKSPKPKFGTYWVKDGKVVGVFLEGGTQEEHKAIAKVARAQPSVE
SLDVLSEEGLSFATKFYSTSL

MAEEKSFKYVIVGGGVAAGYAAREFFNQGVKPGELAIISREQVPPYERPALSKGYIHLEN
KATLPNFYVAAGIGGERQFPQWYKEKGIELILGTEIVKADLAAKTLVSGTGQVFKYQTLL
AATGSSVIRLSDFGVPGADAKNIFYLRELEDADYLAYAMETKEKGKAVVVGGGYIGLELG
AALKANNLDVTMVYPEPWCMPRLFTAGIASFYEGYYANKGINIVKGTVASGFTTNSNGEV
TEVKLKDGRTLEADIVIVGVGGRPIISLFKDQVEEEKGGLKTDGFFKTSLPDVYAIGDVA
TFPMKLYNEMRRVEHVDHARKSAEQAVKAIKAAEEGNSIPEYDYLPYFYSRAFDLSWQFY
GDNVGESVLFGDNDPESPKPKFGSYWIKERKVVGAFLEGGSPEENNAIAKLARAQPSVES
LEVLSKEGLSFATNI

www.000webhost.com

Other information
Ka divergence:-0.540658KaKs divergence:-0.503467
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1326Length 2 (bp):1308Length divergence:-0.007
MFE 1 (kcal):-419.1MFE 2 (kcal):-419.1MFE divergence0