Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09960-AT3G09970
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Calcineurin-like metallo-phosphoesterase superfamily protein
Function (paralog2):Calcineurin-like metallo-phosphoesterase superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.1454500302244
Log2 mRNA fold difference:1.9191713809793
Log2 TE fold difference:0.21730265522869
Sequences
Protein sequence

MMTQKPRTVICVGDIHGNISKLNKLWLNLQSDIQNSDFSSALVIFLGDYCDRGPETRKVI
DFLISLPEKHPDQTHVFLAGNHDFAFAGFLGLLPRPSDGSEFKETWKEYSKSEEREGWYK
GEGFENMHLQSRRWAGKIRVQFDYSAYGVLYNGSIYDAASTFESYGVPHGSSDLIKAVPE
SHKKFLTNMVWVHKEDDVCIETEEGLTHCKLIAVHAGLETKNNVEEQLKLLRDKDTSIPR
IQPLTGRKTVWGIPQELDDKKTIVVSGHHGKLHIDGLRLIIDEGGGYTDTPLAAIVLPSK
KIIRDTDNFSN

MAQKPRTVICVGDIHGYISKLNNLWLNLQSAIDPSDFSSALVIFLGDYCDRGPETRKVID
FLISLPEKHPDQTHVFLAGNHDFAFSGFLGLLPRPSDGSDLKDTWKEYSKSEETEGWYTG
EGFEDMHLQGRRWAGKIKATFNSVKGMAYKGSIYDAGSTFESYGVPHGSSDLMKAVPESH
KKFLTNMVWVHEEDDVCIETEEGLKHCKLIAVHAGLEKGNNVEEQLKLLRAKDTSISKIQ
HLSGRKNVWDIPQELDDKHTVVVSGHHGKLHIDGMRLIIDEGGGFPDKPVAAIVLPSKKI
IRDTDNLSS

www.000webhost.com

Other information
Ka divergence:-0.33289KaKs divergence:0.999756
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):936Length 2 (bp):930Length divergence:-0.003
MFE 1 (kcal):-277.3MFE 2 (kcal):-273.94MFE divergence-0.006